SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL136C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL136C
Domain Number 1 Region: 14-121,196-310
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.94e-26
Family RNA methyltransferase FtsJ 0.0014
Further Details:      
 

Protein sequence

External link(s) Locus: YGL136C   Protein: S000003104
Sequence length 320
Comment MRM2 SGDID:S000003104, Chr VII from 253864-252902, reverse complement, Verified ORF, "Mitochondrial 2' O-ribose methyltransferase, required for methylation of U(2791) in 21S rRNA; MRM2 deletion confers thermosensitive respiration and loss of mitochondrial DNA; has similarity to Spb1p and Trm7p, and to E. coli FtsJ/RrmJ"
Sequence
MILVYNRIRSIISSSLGRIHVRYNSNSQNRWLNRQLKDPYTKEAKVQNLRSRAAFKLMQI
DDKYRLFSKNRTDQRILDLGYAPGAWSQVARQRSSPNSMILGVDILPCEPPHGVNSIQAN
ILAKRTHDLIRLFFSKHFQLNRHDDLHKDHGYFQNMLEEELTHVKDTELYREIFTSDDIY
ETPNTNSTLIEREKFPVDVIISDMYEPWPQTTGFWNNITNQAYFRMANTSGVSIRDHYQS
IDLCDAALVTAIDLLRPLGSFVCKLYTGEEENLFKKRMQAVFTNVHKFKPDASRDESKET
YYIGLKKKRNVDKLDVFSNS
Download sequence
Identical sequences B3LHJ4 C7GPR6 C8Z8B4 E7KCE1 E7KNB2 E7LU84 E7NHJ2 E7QEL2 H0GFU4 P53123
YGL136C YGL136C YGL136C YGL136C YGL136C YGL136C YGL136C YGL136C 4932.YGL136C YGL136C YGL136C SCRT_01130 YGL136C YGL136C YGL136C YGL136C YGL136C

Jump to [ Top of page · Domain architecture · Domain assignment details ]