SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL136C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL136C
Domain Number 1 Region: 14-121,196-310
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.94e-26
Family RNA methyltransferase FtsJ 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.423 15.57
methyltransferase complex 2.218 10.08
transcription factor complex 1.912 8.54
organelle inner membrane 1.669 7.47
mitochondrial envelope 1.573 7.47
mitochondrial membrane part 1.917 7.47
trans-Golgi network 1.793 6.98
nucleolus 1.641 6.45
chromosomal part 1.477 5.56
chromatin 1.822 5.56
Biological Process IC (bits) H-Score
protein methylation 2.061 71.79
RNA modification 2.179 57.12
mRNA metabolic process 1.622 33.93
ncRNA metabolic process 1.572 27.74
RNA processing 1.457 24.7
regulation of gene silencing 2.227 21.93
DNA modification 1.931 20.52
sulfur compound metabolic process 1.457 19.59
coenzyme metabolic process 1.622 19.59
mitochondrion organization 1.548 19.49

Protein sequence

External link(s) Locus: YGL136C   Protein: S000003104
Sequence length 320
Comment MRM2 SGDID:S000003104, Chr VII from 253864-252902, reverse complement, Verified ORF, "Mitochondrial 2' O-ribose methyltransferase, required for methylation of U(2791) in 21S rRNA; MRM2 deletion confers thermosensitive respiration and loss of mitochondrial DNA; has similarity to Spb1p and Trm7p, and to E. coli FtsJ/RrmJ"
Sequence
MILVYNRIRSIISSSLGRIHVRYNSNSQNRWLNRQLKDPYTKEAKVQNLRSRAAFKLMQI
DDKYRLFSKNRTDQRILDLGYAPGAWSQVARQRSSPNSMILGVDILPCEPPHGVNSIQAN
ILAKRTHDLIRLFFSKHFQLNRHDDLHKDHGYFQNMLEEELTHVKDTELYREIFTSDDIY
ETPNTNSTLIEREKFPVDVIISDMYEPWPQTTGFWNNITNQAYFRMANTSGVSIRDHYQS
IDLCDAALVTAIDLLRPLGSFVCKLYTGEEENLFKKRMQAVFTNVHKFKPDASRDESKET
YYIGLKKKRNVDKLDVFSNS
Download sequence
Identical sequences B3LHJ4 C7GPR6 C8Z8B4 E7KCE1 E7KNB2 E7LU84 E7NHJ2 E7QEL2 H0GFU4 N1P3D6 P53123 W7Q458 W7QYY6
SCRT_01130 YGL136C YGL136C YGL136C YGL136C YGL136C YGL136C YGL136C YGL136C YGL136C 4932.YGL136C YGL136C YGL136C YGL136C YGL136C YGL136C YGL136C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]