SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL167C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL167C
Domain Number 1 Region: 37-151,270-363,728-939
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.79e-124
Family Calcium ATPase, transmembrane domain M 0.00011
Further Details:      
 
Domain Number 2 Region: 367-387,530-781
Classification Level Classification E-value
Superfamily HAD-like 3.93e-58
Family Meta-cation ATPase, catalytic domain P 8.52e-05
Further Details:      
 
Domain Number 3 Region: 375-586
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 7.85e-48
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00042
Further Details:      
 
Domain Number 4 Region: 150-269
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.14e-26
Family Calcium ATPase, transduction domain A 0.00059
Further Details:      
 

Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
ATPase activity, coupled to movement of substances 2.026 80.17
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances 2.026 75.77
P-P-bond-hydrolysis-driven transmembrane transporter activity 1.989 74.96
phosphoric ester hydrolase activity 1.603 66.88
ATPase activity, coupled 1.557 55.5
metal ion transmembrane transporter activity 1.668 51.24
magnesium ion binding 2.011 50.86
isomerase activity 1.671 12.42
copper ion binding 2.11 12.05
transferase activity, transferring hexosyl groups 2.238 11.79
Cellular Component IC (bits) H-Score
integral to plasma membrane 1.468 35.69
organelle inner membrane 1.676 21.6
mitochondrial envelope 1.579 21.6
mitochondrial inner membrane 1.756 21.6
mitochondrial membrane part 1.918 21.6
nuclear outer membrane-endoplasmic reticulum membrane network 1.56 13.22
endoplasmic reticulum part 1.433 9.54
sarcoplasmic reticulum 1.999 8.53
trans-Golgi network 1.798 8.33
coated vesicle 1.745 7.29
Biological Process IC (bits) H-Score
dephosphorylation 2.002 74.48
transmembrane transport 1.511 33.08
monovalent inorganic cation transport 2.047 26.6
positive regulation of multicellular organismal process 1.345 22.48
muscle contraction 1.402 21.3
regulation of steroid metabolic process 2.236 18.24
carbohydrate derivative biosynthetic process 1.387 16.25
amino sugar metabolic process 2.236 16.25
phenol-containing compound metabolic process 1.864 15.72
cofactor metabolic process 1.433 15.22

Protein sequence

External link(s) Locus: YGL167C   Protein: S000003135
Sequence length 950
Comment PMR1 SGDID:S000003135, Chr VII from 190474-187622, reverse complement, Verified ORF, "High affinity Ca2+/Mn2+ P-type ATPase required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting and processing; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease"
Sequence
MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS
SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI
TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG
DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM
GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM
ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE
TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE
DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK
RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM
ASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI
IMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEH
KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST
ILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGP
PAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKV
TARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPF
FQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRKKNEEDSTYFSNV
Download sequence
Identical sequences N1P4N3 P13586
YGL167C YGL167C 4932.YGL167C YGL167C 4070 YGL167C YGL167C YGL167C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]