SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL167C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL167C
Domain Number 1 Region: 37-151,270-363,728-939
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.79e-124
Family Calcium ATPase, transmembrane domain M 0.00011
Further Details:      
 
Domain Number 2 Region: 367-387,530-781
Classification Level Classification E-value
Superfamily HAD-like 3.93e-58
Family Meta-cation ATPase, catalytic domain P 0.0000852
Further Details:      
 
Domain Number 3 Region: 375-586
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 7.85e-48
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00042
Further Details:      
 
Domain Number 4 Region: 150-269
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.14e-26
Family Calcium ATPase, transduction domain A 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YGL167C   Protein: S000003135
Sequence length 950
Comment PMR1 SGDID:S000003135, Chr VII from 190474-187622, reverse complement, Verified ORF, "High affinity Ca2+/Mn2+ P-type ATPase required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting and processing; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease"
Sequence
MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS
SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI
TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG
DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM
GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM
ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE
TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE
DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK
RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM
ASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI
IMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEH
KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST
ILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGP
PAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKV
TARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPF
FQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRKKNEEDSTYFSNV
Download sequence
Identical sequences N1P4N3 P13586
YGL167C YGL167C 4070 YGL167C YGL167C 4932.YGL167C YGL167C YGL167C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]