SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL167C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL167C
Domain Number 1 Region: 37-151,270-363,728-939
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.79e-124
Family Calcium ATPase, transmembrane domain M 0.00011
Further Details:      
 
Domain Number 2 Region: 367-387,530-781
Classification Level Classification E-value
Superfamily HAD-like 3.93e-58
Family Meta-cation ATPase, catalytic domain P 8.52e-05
Further Details:      
 
Domain Number 3 Region: 375-586
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 7.85e-48
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00042
Further Details:      
 
Domain Number 4 Region: 150-269
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.14e-26
Family Calcium ATPase, transduction domain A 0.00059
Further Details:      
 

Protein sequence

External link(s) Locus: YGL167C   Protein: S000003135
Sequence length 950
Comment PMR1 SGDID:S000003135, Chr VII from 190474-187622, reverse complement, Verified ORF, "High affinity Ca2+/Mn2+ P-type ATPase required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting and processing; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease"
Sequence
MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS
SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI
TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG
DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM
GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM
ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE
TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE
DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK
RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM
ASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI
IMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEH
KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST
ILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGP
PAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKV
TARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPF
FQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRKKNEEDSTYFSNV
Download sequence
Identical sequences N1P4N3 P13586
YGL167C YGL167C 4932.YGL167C YGL167C 4070 YGL167C YGL167C YGL167C

Jump to [ Top of page · Domain architecture · Domain assignment details ]