SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL171W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL171W
Domain Number 1 Region: 153-213,250-479
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-59
Family Tandem AAA-ATPase domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.998 25.22
chromosomal part 1.478 20.33
nucleoplasm part 1.419 15.58
endosome 1.322 14.28
cilium 1.61 13.75
extrinsic to plasma membrane 1.991 12.72
internal side of plasma membrane 2.098 12.69
extracellular organelle 1.592 12.36
transcription factor complex 1.881 9.42
DNA-directed RNA polymerase complex 2.004 9.42

Protein sequence

External link(s) Locus: YGL171W   Protein: S000003139
Sequence length 564
Comment ROK1 SGDID:S000003139, Chr VII from 182396-184090, Verified ORF, "ATP-dependent RNA helicase of the DEAD box family; required for 18S rRNA synthesis"
Sequence
MDIFRVLTRGASVKKESGPKAKAADYSVINGNDENHKEDNNESQIVKELDFFRNKRIISK
VEDDREKTTENDSPNKEEKSGNDDGLIKPVITNTVEASALRKSYKGNVSGIDIPLPIGSF
EDLISRFSFDKRLLNNLIENGFTEPTPIQCECIPVALNNRDVLACGPTGSGKTLAFLIPL
VQQIIDDKQTAGLKGLIISPTKELANQIFIECFKLSYKIFLEKKRPLQVALLSKSLGAKL
KNKVVSDKKYDIIISTPLRLIDVVKNEALDLSKVKHLIFDEADKLFDKTFVEQSDDILSA
CREPSLRKAMFSATIPSNVEEIAQSIMMDPVRVIIGHKEAANTNIEQKLIFCGNEEGKLI
AIRQLVQEGEFKPPIIIFLESITRAKALYHELMYDRINVDVIHAERTALQRDRIIERFKT
GELWCLICTDVLARGIDFKGVNLVINYDVPGSSQAYVHRIGRTGRGGRSGKAITFYTKQD
SVAIKPIINVMKQSGCEVSEWMDKMAKMTRKEKESIKNGKAHKERKQITTVPKMDKAKRR
RQQEMIAASKRRKNEELSKKHFSK
Download sequence
Identical sequences N1P4C1 P45818
YGL171W 4932.YGL171W YGL171w___KOG0344 YGL171W YGL171W YGL171W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]