SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL171W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL171W
Domain Number 1 Region: 153-213,250-479
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-59
Family Tandem AAA-ATPase domain 0.00056
Further Details:      
 

Protein sequence

External link(s) Locus: YGL171W   Protein: S000003139
Sequence length 564
Comment ROK1 SGDID:S000003139, Chr VII from 182396-184090, Verified ORF, "ATP-dependent RNA helicase of the DEAD box family; required for 18S rRNA synthesis"
Sequence
MDIFRVLTRGASVKKESGPKAKAADYSVINGNDENHKEDNNESQIVKELDFFRNKRIISK
VEDDREKTTENDSPNKEEKSGNDDGLIKPVITNTVEASALRKSYKGNVSGIDIPLPIGSF
EDLISRFSFDKRLLNNLIENGFTEPTPIQCECIPVALNNRDVLACGPTGSGKTLAFLIPL
VQQIIDDKQTAGLKGLIISPTKELANQIFIECFKLSYKIFLEKKRPLQVALLSKSLGAKL
KNKVVSDKKYDIIISTPLRLIDVVKNEALDLSKVKHLIFDEADKLFDKTFVEQSDDILSA
CREPSLRKAMFSATIPSNVEEIAQSIMMDPVRVIIGHKEAANTNIEQKLIFCGNEEGKLI
AIRQLVQEGEFKPPIIIFLESITRAKALYHELMYDRINVDVIHAERTALQRDRIIERFKT
GELWCLICTDVLARGIDFKGVNLVINYDVPGSSQAYVHRIGRTGRGGRSGKAITFYTKQD
SVAIKPIINVMKQSGCEVSEWMDKMAKMTRKEKESIKNGKAHKERKQITTVPKMDKAKRR
RQQEMIAASKRRKNEELSKKHFSK
Download sequence
Identical sequences N1P4C1 P45818
YGL171W 4932.YGL171W YGL171w___KOG0344 YGL171W YGL171W YGL171W

Jump to [ Top of page · Domain architecture · Domain assignment details ]