SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL172W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGL172W   Protein: S000003140
Sequence length 472
Comment NUP49 SGDID:S000003140, Chr VII from 180706-182124, Verified ORF, "Subunit of the Nsp1p-Nup57p-Nup49p-Nic96p subcomplex of the nuclear pore complex (NPC), required for nuclear export of ribosomes"
Sequence
MFGLNKASSTPAGGLFGQASGASTGNANTGFSFGGTQTGQNTGPSTGGLFGAKPAGSTGG
LGASFGQQQQQSQTNAFGGSATTGGGLFGNKPNNTANTGGGLFGANSNSNSGSLFGSNNA
QTSRGLFGNNNTNNINNSSSGMNNASAGLFGSKPAGGTSLFGNTSTSSAPAQNQGMFGAK
PAGTSLFGNNAGNTTTGGGLFGSKPTGATSLFGSSNNNNNNNNSNNIMSASGGLFGNQQQ
QLQQQPQMQCALQNLSQLPITPMTRISELPPQIRQEIEQLDQYIQKQVQISHHLKADTID
HDELIDSIPRDVAYLLKSESATSQYLKQDLKKISSFKSLIDEDLLDTQTFSVLLQQLLTP
GSKISSNDLDKFFQKKIHLYEKKLEDYCRILSDIETAVNGIDTDLFGAPNNPNSTAITAD
LGSSEAENLLQLKTGLAAIVSTVIEEFTLFMDIAERIAVLHQKTKTLASLSI
Download sequence
Identical sequences N1P6F0 Q02199
YGL172W YGL172W 4932.YGL172W YGL172W NYSGXRC-15049a YGL172W YGL172W

Jump to [ Top of page · Domain architecture · Domain assignment details ]