SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL175C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL175C   Protein: S000003143
Sequence length 345
Comment SAE2 SGDID:S000003143, Chr VII from 174328-173291, reverse complement, Verified ORF, "Endonuclease that processes hairpin DNA structures with the MRX complex; involved in meiotic and mitotic double-strand break repair; phosphorylated in response to DNA damage and required for normal resistance to DNA-damaging agents"
Sequence
MVTGEENVYLKSSLSILKELSLDELLNVQYDVTTLIAKRVQALQNRNKCVLEEPNSKLAE
ILCHEKNAPQQSSQTSAGPGEQDSEDFILTQFDEDIKKESAEVHYRNENKHTVQLPLVTM
PPNRHKRKISEFSSPLNGLNNLSDLEDCSDTVIHEKDNDKENKTRKLLGIELENPESTSP
NLYKNVKDNFLFDFNTNPLTKRAWILEDFRPNEDIAPVKRGRRKLERFYAQVGKPEDSKH
RSLSVVIESQNSDYEFAFDNLRNRSKSPPGFGRLDFPSTQEGNEDKKKSQEIIRRKTKYR
FLMASNNKIPPYEREYVFKREQLNQIVDDGCFFWSDKLLQIYARC
Download sequence
Identical sequences N1P4B4 P46946
YGL175C YGL175C YT449 4932.YGL175C YGL175C YGL175C YGL175C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]