SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL175C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGL175C   Protein: S000003143
Sequence length 345
Comment SAE2 SGDID:S000003143, Chr VII from 174328-173291, reverse complement, Verified ORF, "Endonuclease that processes hairpin DNA structures with the MRX complex; involved in meiotic and mitotic double-strand break repair; phosphorylated in response to DNA damage and required for normal resistance to DNA-damaging agents"
Sequence
MVTGEENVYLKSSLSILKELSLDELLNVQYDVTTLIAKRVQALQNRNKCVLEEPNSKLAE
ILCHEKNAPQQSSQTSAGPGEQDSEDFILTQFDEDIKKESAEVHYRNENKHTVQLPLVTM
PPNRHKRKISEFSSPLNGLNNLSDLEDCSDTVIHEKDNDKENKTRKLLGIELENPESTSP
NLYKNVKDNFLFDFNTNPLTKRAWILEDFRPNEDIAPVKRGRRKLERFYAQVGKPEDSKH
RSLSVVIESQNSDYEFAFDNLRNRSKSPPGFGRLDFPSTQEGNEDKKKSQEIIRRKTKYR
FLMASNNKIPPYEREYVFKREQLNQIVDDGCFFWSDKLLQIYARC
Download sequence
Identical sequences N1P4B4 P46946
YGL175C YGL175C 4932.YGL175C YGL175C YT449 YGL175C YGL175C

Jump to [ Top of page · Domain architecture · Domain assignment details ]