SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL194C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL194C-A   Protein: S000087160
Sequence length 80
Comment YGL194C-A SGDID:S000087160, Chr VII from 139967-139725, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, identified based on comparisons of the genome sequences of six Saccharomyces species"
Sequence
MSNKEITCIKPFKIIALILLIVLIINLSYKLFLRRYLKSTVIWCLGIANTDRNDMMWWQV
SPLLERWVWQLVDNYESGYE
Download sequence
Identical sequences A6ZTZ4 G2WDR2 Q2V2P6
YGL194C-A 4932.YGL194C-A YGL194C-A YGL194C-A YGL194C-A YGL194C-A tr|A6ZTZ4|A6ZTZ4_YEAS7 YGL194C-A YGL194C-A YGL194C-A YGL194C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]