SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL201C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL201C
Domain Number 1 Region: 132-195,262-406
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.8e-62
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00046
Further Details:      
 
Domain Number 2 Region: 535-846
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.85e-40
Family Extended AAA-ATPase domain 0.034
Further Details:      
 

Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
purine ribonucleoside binding 1.42 72.62
guanyl nucleotide binding 2.074 71.86
purine ribonucleoside triphosphate binding 1.453 69.94
ATPase activity, coupled 1.557 68.47
purine NTP-dependent helicase activity 2.034 68.47
phosphotransferase activity, phosphate group as acceptor 2.214 36.72
P-P-bond-hydrolysis-driven transmembrane transporter activity 1.989 35.05
translation factor activity, nucleic acid binding 1.873 18.7
nucleic acid binding transcription factor activity 1.655 16.49
structural constituent of ribosome 1.982 16.17
Cellular Component IC (bits) H-Score
microtubule associated complex 1.999 25.68
chromosomal part 1.477 20.4
ribosomal subunit 2.012 19.51
nucleoplasm part 1.418 15.58
endosome 1.325 13.96
cilium 1.617 13.18
extrinsic to plasma membrane 1.993 12.72
internal side of plasma membrane 2.099 12.47
extracellular organelle 1.593 12.35
ribonucleoprotein complex 1.418 9.43
Biological Process IC (bits) H-Score
purine nucleoside triphosphate metabolic process 1.5 117.65
glycosyl compound catabolic process 1.531 110.77
purine-containing compound catabolic process 1.507 109.32
purine ribonucleoside metabolic process 1.419 107.67
organophosphate catabolic process 1.496 104.78
purine ribonucleotide metabolic process 1.37 103.88
carbohydrate derivative catabolic process 1.425 98.11
nucleobase-containing compound catabolic process 1.341 89.06
purine ribonucleoside monophosphate metabolic process 1.46 88.25
DNA conformation change 1.678 48.54

Protein sequence

External link(s) Locus: YGL201C   Protein: S000003169
Sequence length 1017
Comment MCM6 SGDID:S000003169, Chr VII from 120911-117858, reverse complement, Verified ORF, "Protein involved in DNA replication; component of the Mcm2-7 hexameric complex that binds chromatin as a part of the pre-replicative complex"
Sequence
MSSPFPADTPSSNRPSNSSPPPSSIGAGFGSSSGLDSQIGSRLHFPSSSQPHVSNSQTGP
FVNDSTQFSSQRLQTDGSATNDMEGNEPARSFKSRALNHVKKVDDVTGEKVREAFEQFLE
DFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPF
LQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGN
GTSAMATRSITTSTSPEQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEV
RPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVR
IQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSST
LDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRET
ELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGH
EAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSG
KASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQT
ISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCN
EKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKEL
RKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDV
DDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKK
KTTVTYDKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRL
AFKVIKRLVKDRILMEIHGTRHNLRDLENEENENNKTVYVIHPNCEVLDQLEPQDSS
Download sequence
Identical sequences P53091
YGL201C 4932.YGL201C YGL201C YGL201C YGL201C YGL201C YGL201C YR257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]