SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGL201C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL201C
Domain Number 1 Region: 132-195,262-406
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.8e-62
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00046
Further Details:      
 
Domain Number 2 Region: 535-846
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.85e-40
Family Extended AAA-ATPase domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
chromosomal region 1.996 30.26
actin cytoskeleton 1.374 29.03
aminoacyl-tRNA synthetase multienzyme complex 2.213 25.16
cilium 1.675 22.42
ribosomal subunit 1.983 22.4
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6

Protein sequence

External link(s) Locus: YGL201C   Protein: S000003169
Sequence length 1017
Comment MCM6 SGDID:S000003169, Chr VII from 120911-117858, reverse complement, Verified ORF, "Protein involved in DNA replication; component of the Mcm2-7 hexameric complex that binds chromatin as a part of the pre-replicative complex"
Sequence
MSSPFPADTPSSNRPSNSSPPPSSIGAGFGSSSGLDSQIGSRLHFPSSSQPHVSNSQTGP
FVNDSTQFSSQRLQTDGSATNDMEGNEPARSFKSRALNHVKKVDDVTGEKVREAFEQFLE
DFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPF
LQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGN
GTSAMATRSITTSTSPEQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEV
RPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVR
IQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSST
LDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRET
ELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGH
EAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSG
KASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQT
ISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCN
EKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKEL
RKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDV
DDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKK
KTTVTYDKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRL
AFKVIKRLVKDRILMEIHGTRHNLRDLENEENENNKTVYVIHPNCEVLDQLEPQDSS
Download sequence
Identical sequences P53091
YGL201C YGL201C YGL201C YGL201C YGL201C 3ja8.6 3jc5.6 3jc6.6 3jc7.6 5h7i.6 5u8s.6 5u8t.6 5udb.6 5v8f.6 5xf8.6 4932.YGL201C YR257 YGL201C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]