SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL208W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL208W
Domain Number 1 Region: 307-412
Classification Level Classification E-value
Superfamily AMPKBI-like 3.92e-33
Family AMPKBI-like 6.85e-07
Further Details:      
 
Domain Number 2 Region: 163-246
Classification Level Classification E-value
Superfamily E set domains 1.05e-23
Family AMPK-beta glycogen binding domain-like 6.37e-06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
receptor complex 1.51 25.82
extracellular space 1.523 24.02
integral to plasma membrane 1.469 16.65
cation channel complex 2.038 9.34
nucleoplasm part 1.419 8.47
transcription factor complex 1.881 8.47
cell cortex 1.621 8.45
photoreceptor inner segment 2.239 6.53
nonmotile primary cilium 1.973 6.22
actin filament 2.158 5.11

Protein sequence

External link(s) Locus: YGL208W   Protein: S000003176
Sequence length 415
Comment SIP2 SGDID:S000003176, Chr VII from 97342-98589, Verified ORF, "One of three beta subunits of the Snf1 serine/threonine protein kinase complex involved in the response to glucose starvation; null mutants exhibit accelerated aging; N-myristoylprotein localized to the cytoplasm and the plasma membrane"
Sequence
MGTTTSHPAQKKQTTKKCRAPIMSDVREKPSNAQGCEPQEMDAVSKKVTELSLNKCSDSQ
DAGQPSREGSITKKKSTLLLRDEDEPTMPKLSVMETAVDTDSGSSSTSDDEEGDIIAQTT
EPKQDASPDDDRSGHSSPREEGQQQIRAKEASGGPSEIKSSLMVPVEIRWQQGGSKVYVT
GSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFV
NYIEVRQPEKNPTNEKIRSKEADSMRPPTSDRSSIALQIGKDPDDFGDGYTRFHEDLSPR
PPLEYTTDIPAVFTDPSVMERYYYTLDRQQSNTDTSWLTPPQLPPQLENVILNKYYATQD
QFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIESS
Download sequence
Identical sequences P34164
YGL208W 4932.YGL208W YGL208W YGL208W YGL208W YGL208W YGL208W 355340 YGL208W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]