SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL208W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL208W
Domain Number 1 Region: 307-412
Classification Level Classification E-value
Superfamily AMPKBI-like 3.92e-33
Family AMPKBI-like 6.85e-07
Further Details:      
 
Domain Number 2 Region: 163-246
Classification Level Classification E-value
Superfamily E set domains 1.05e-23
Family AMPK-beta glycogen binding domain-like 6.37e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YGL208W   Protein: S000003176
Sequence length 415
Comment SIP2 SGDID:S000003176, Chr VII from 97342-98589, Verified ORF, "One of three beta subunits of the Snf1 serine/threonine protein kinase complex involved in the response to glucose starvation; null mutants exhibit accelerated aging; N-myristoylprotein localized to the cytoplasm and the plasma membrane"
Sequence
MGTTTSHPAQKKQTTKKCRAPIMSDVREKPSNAQGCEPQEMDAVSKKVTELSLNKCSDSQ
DAGQPSREGSITKKKSTLLLRDEDEPTMPKLSVMETAVDTDSGSSSTSDDEEGDIIAQTT
EPKQDASPDDDRSGHSSPREEGQQQIRAKEASGGPSEIKSSLMVPVEIRWQQGGSKVYVT
GSFTKWRKMIGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFV
NYIEVRQPEKNPTNEKIRSKEADSMRPPTSDRSSIALQIGKDPDDFGDGYTRFHEDLSPR
PPLEYTTDIPAVFTDPSVMERYYYTLDRQQSNTDTSWLTPPQLPPQLENVILNKYYATQD
QFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIESS
Download sequence
Identical sequences P34164
YGL208W 4932.YGL208W YGL208W YGL208W YGL208W YGL208W YGL208W 355340 YGL208W

Jump to [ Top of page · Domain architecture · Domain assignment details ]