SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL209W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL209W
Domain Number 1 Region: 31-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-14
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Weak hits

Sequence:  YGL209W
Domain Number - Region: 13-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0223
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.419 14.78
nucleolus 1.651 6.38
SWI/SNF superfamily-type complex 2.177 5.46
chromosomal part 1.478 5.28
ribonucleoprotein complex 1.415 5.06
small nuclear ribonucleoprotein complex 2.004 5.06
chromatin 1.906 4.81
nuclear body 1.911 3.96

Protein sequence

External link(s) Locus: YGL209W   Protein: S000003177
Sequence length 382
Comment MIG2 SGDID:S000003177, Chr VII from 95862-97010, Verified ORF, "Protein containing zinc fingers, involved in repression, along with Mig1p, of SUC2 (invertase) expression by high levels of glucose; binds to Mig1p-binding sites in SUC2 promoter"
Sequence
MPKKQTNFPVDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSD
ELKRHMRTHTGQSQRRLKKASVQKQEFLTVSGIPTIASGVMIHQPIPQVLPANMAINVQA
VNGGNIIHAPNAVHPMVIPIMAQPAPIHASAASFQPATSPMPISTYTPVPSQSFTSFQSS
IGSIQSNSDVSSIFSNMNVRVNTPRSVPNSPNDGYLHQQHIPQQYQHQTASPSVAKQQKT
FAHSLASALSTLQKRTPVSAPSTTIESPSSPSDSSHTSASSSAISLPFSNAPSQLAVAKE
LESVYLDSNRYTTKTRRERAKFEIPEEQEEDTNNSSSGSNEEEHESLDHESSKSRKKLSG
VKLPPVRNLLKQIDVFNGPKRV
Download sequence
Identical sequences P53035
YGL209W YGL209W 4932.YGL209W YGL209W YGL209W YGL209W YGL209W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]