SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL209W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL209W
Domain Number 1 Region: 31-71
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-14
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Weak hits

Sequence:  YGL209W
Domain Number - Region: 13-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0223
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Protein sequence

External link(s) Locus: YGL209W   Protein: S000003177
Sequence length 382
Comment MIG2 SGDID:S000003177, Chr VII from 95862-97010, Verified ORF, "Protein containing zinc fingers, involved in repression, along with Mig1p, of SUC2 (invertase) expression by high levels of glucose; binds to Mig1p-binding sites in SUC2 promoter"
Sequence
MPKKQTNFPVDNENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSD
ELKRHMRTHTGQSQRRLKKASVQKQEFLTVSGIPTIASGVMIHQPIPQVLPANMAINVQA
VNGGNIIHAPNAVHPMVIPIMAQPAPIHASAASFQPATSPMPISTYTPVPSQSFTSFQSS
IGSIQSNSDVSSIFSNMNVRVNTPRSVPNSPNDGYLHQQHIPQQYQHQTASPSVAKQQKT
FAHSLASALSTLQKRTPVSAPSTTIESPSSPSDSSHTSASSSAISLPFSNAPSQLAVAKE
LESVYLDSNRYTTKTRRERAKFEIPEEQEEDTNNSSSGSNEEEHESLDHESSKSRKKLSG
VKLPPVRNLLKQIDVFNGPKRV
Download sequence
Identical sequences P53035
YGL209W YGL209W 4932.YGL209W YGL209W YGL209W YGL209W YGL209W

Jump to [ Top of page · Domain architecture · Domain assignment details ]