SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGL213C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL213C
Domain Number 1 Region: 7-391
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.75e-43
Family WD40-repeat 0.000000000000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL213C   Protein: S000003181
Sequence length 397
Comment SKI8 SGDID:S000003181, Chr VII from 91251-90058, reverse complement, Verified ORF, "Protein involved in exosome mediated 3' to 5' mRNA degradation and translation inhibition of non-poly(A) mRNAs as well as double-strand break formation during meiotic recombination; required for repressing propagation of dsRNA viruses"
Sequence
MSKVFIATANAGKAHDADIFSVSACNSFTVSCSGDGYLKVWDNKLLDNENPKDKSYSHFV
HKSGLHHVDVLQAIERDAFELCLVATTSFSGDLLFYRITREDETKKVIFEKLDLLDSDMK
KHSFWALKWGASNDRLLSHRLVATDVKGTTYIWKFHPFADESNSLTLNWSPTLELQGTVE
SPMTPSQFATSVDISERGLIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVK
FSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVPTHSSQASLGEFAHSSWVMSLSFN
DSGETLCSAGWDGKLRFWDVKTKERITTLNMHCDDIEIEEDILAVDEHGDSLAEPGVFDV
KFLKKGWRSGMGADLNESLCCVCLDRSIRWFREAGGK
Download sequence
Identical sequences N1P427 Q02793
YGL213C 354931 NP_011302.1.97178 YGL213C YGL213C 1sq9.A 4buj.C 4buj.D 4buj.G 4buj.H 5mc6.j 5mc6.k YGL213C 1sq9A cath|current|1sq9A00/3-395 cath|current|4bujC00/2-397 cath|current|4bujD00/3-397 cath|current|4bujG00/2-397 cath|current|4bujH00/3-394 YGL213C YGL213C 4932.YGL213C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]