SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL213C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL213C
Domain Number 1 Region: 7-391
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.75e-43
Family WD40-repeat 5.51e-13
Further Details:      
 

Protein sequence

External link(s) Locus: YGL213C   Protein: S000003181
Sequence length 397
Comment SKI8 SGDID:S000003181, Chr VII from 91251-90058, reverse complement, Verified ORF, "Protein involved in exosome mediated 3' to 5' mRNA degradation and translation inhibition of non-poly(A) mRNAs as well as double-strand break formation during meiotic recombination; required for repressing propagation of dsRNA viruses"
Sequence
MSKVFIATANAGKAHDADIFSVSACNSFTVSCSGDGYLKVWDNKLLDNENPKDKSYSHFV
HKSGLHHVDVLQAIERDAFELCLVATTSFSGDLLFYRITREDETKKVIFEKLDLLDSDMK
KHSFWALKWGASNDRLLSHRLVATDVKGTTYIWKFHPFADESNSLTLNWSPTLELQGTVE
SPMTPSQFATSVDISERGLIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVK
FSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVPTHSSQASLGEFAHSSWVMSLSFN
DSGETLCSAGWDGKLRFWDVKTKERITTLNMHCDDIEIEEDILAVDEHGDSLAEPGVFDV
KFLKKGWRSGMGADLNESLCCVCLDRSIRWFREAGGK
Download sequence
Identical sequences Q02793
YGL213C 1sq9A 4932.YGL213C YGL213C YGL213C YGL213C 1sq9.A YGL213C 354931 YGL213C

Jump to [ Top of page · Domain architecture · Domain assignment details ]