SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL214W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGL214W   Protein: S000003182
Sequence length 162
Comment YGL214W SGDID:S000003182, Chr VII from 90011-90499, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; deletion mutation phenotype is likely due to the overlapping verified ORF SKI8/YGL213C"
Sequence
MDDVRLHAIYQDITRDYLPPASLNHLMLLSKQTQHKLSFKSAPIPDLQPFFKNFTSKTPG
SAKESPCSSTAKISSSISISSQCIFNVVILSFVFTSQNLNLPSHPALHNVSPESLNDRLM
TQLECANSPRLACELWVGTDKEPILSPNSVSYRVMQPNEFES
Download sequence
Identical sequences YGL214W 4932.YGL214W YT701

Jump to [ Top of page · Domain architecture · Domain assignment details ]