SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YGL214W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YGL214W   Protein: S000003182
Sequence length 162
Comment YGL214W SGDID:S000003182, Chr VII from 90011-90499, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; deletion mutation phenotype is likely due to the overlapping verified ORF SKI8/YGL213C"
Sequence
MDDVRLHAIYQDITRDYLPPASLNHLMLLSKQTQHKLSFKSAPIPDLQPFFKNFTSKTPG
SAKESPCSSTAKISSSISISSQCIFNVVILSFVFTSQNLNLPSHPALHNVSPESLNDRLM
TQLECANSPRLACELWVGTDKEPILSPNSVSYRVMQPNEFES
Download sequence
Identical sequences YT701 YGL214W 4932.YGL214W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]