SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGL245W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL245W
Domain Number 1 Region: 202-514
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.78e-88
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 3.4e-07
Further Details:      
 
Domain Number 2 Region: 509-699
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 6.8e-52
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.00065
Further Details:      
 
Domain Number 3 Region: 67-163
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.14e-12
Family Glutathione S-transferase (GST), C-terminal domain 0.038
Further Details:      
 

Protein sequence

External link(s) Locus: YGL245W   Protein: S000003214
Sequence length 708
Comment GUS1 SGDID:S000003214, Chr VII from 39023-41149, Verified ORF, "Glutamyl-tRNA synthetase (GluRS), forms a complex with methionyl-tRNA synthetase (Mes1p) and Arc1p; complex formation increases the catalytic efficiency of both tRNA synthetases and ensures their correct localization to the cytoplasm"
Sequence
MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKIT
SKFAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAA
DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVG
KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
DDTNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT
EKMREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV
IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRL
RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV
LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKH
KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEG
DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN
VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
Download sequence
Identical sequences A6ZTU6 B3LHT7 C7GNZ1 N1P367 P46655 W7PH83 W7RKF3
YGL245W 4932.YGL245W YGL245W YGL245W SCRT_01229 YGL245W YGL245W YGL245W tr|A6ZTU6|A6ZTU6_YEAS7 YGL245W YGL245W YGL245W YGL245W YGL245W

Jump to [ Top of page · Domain architecture · Domain assignment details ]