SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YGR019W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR019W
Domain Number 1 Region: 38-471
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.11e-85
Family GABA-aminotransferase-like 0.0000000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear outer membrane-endoplasmic reticulum membrane network 1.559 41.9
endoplasmic reticulum part 1.433 41.9
mitochondrial matrix 1.707 9.9
mitochondrial envelope 1.571 5.13
mitochondrial inner membrane 1.752 5.13
organelle inner membrane 1.673 4.91
microbody 1.956 4.39
plastid 1.598 3.87

Protein sequence

External link(s) Locus: YGR019W   Protein: S000003251
Sequence length 471
Comment UGA1 SGDID:S000003251, Chr VII from 525233-526648, Verified ORF, "Gamma-aminobutyrate (GABA) transaminase (4-aminobutyrate aminotransferase) involved in the 4-aminobutyrate and glutamate degradation pathways; required for normal oxidative stress tolerance and nitrogen utilization"
Sequence
MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYEKSLGNYITDV
DGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDRPALGNFPSKDLDKILKQILK
SAPKGQDHVWSGLSGADANELAFKAAFIYYRAKQRGYDADFSEKENLSVMDNDAPGAPHL
AVLSFKRAFHGRLFASGSTTCSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDH
CLAIVEELIKTWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG
VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFNTWCGEPARMI
IAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENFQNLRGKGRGTFIAWDLPTGE
KRDLLLKKLKLNGCNVGGCAVHAVRLRPSLTFEEKHADIFIEALAKSVNEL
Download sequence
Identical sequences N1P3S6 P17649
4932.YGR019W YGR019W YGR019W YGR019W YGR019W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]