SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR019W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR019W
Domain Number 1 Region: 38-471
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.11e-85
Family GABA-aminotransferase-like 5.64e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YGR019W   Protein: S000003251
Sequence length 471
Comment UGA1 SGDID:S000003251, Chr VII from 525233-526648, Verified ORF, "Gamma-aminobutyrate (GABA) transaminase (4-aminobutyrate aminotransferase) involved in the 4-aminobutyrate and glutamate degradation pathways; required for normal oxidative stress tolerance and nitrogen utilization"
Sequence
MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYEKSLGNYITDV
DGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDRPALGNFPSKDLDKILKQILK
SAPKGQDHVWSGLSGADANELAFKAAFIYYRAKQRGYDADFSEKENLSVMDNDAPGAPHL
AVLSFKRAFHGRLFASGSTTCSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDH
CLAIVEELIKTWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG
VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFNTWCGEPARMI
IAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENFQNLRGKGRGTFIAWDLPTGE
KRDLLLKKLKLNGCNVGGCAVHAVRLRPSLTFEEKHADIFIEALAKSVNEL
Download sequence
Identical sequences N1P3S6 P17649
YGR019W YGR019W 4932.YGR019W YGR019W YGR019W

Jump to [ Top of page · Domain architecture · Domain assignment details ]