SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR019W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR019W
Domain Number 1 Region: 38-471
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.11e-85
Family GABA-aminotransferase-like 0.0000000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.423 41.94
endoplasmic reticulum part 1.431 41.94
mitochondrial matrix 1.714 9.9
oxidoreductase complex 1.872 8.82
mitochondrial envelope 1.573 5.12
organelle inner membrane 1.669 4.89
microbody 1.95 4.39
plastid 1.6 3.84

Protein sequence

External link(s) Locus: YGR019W   Protein: S000003251
Sequence length 471
Comment UGA1 SGDID:S000003251, Chr VII from 525233-526648, Verified ORF, "Gamma-aminobutyrate (GABA) transaminase (4-aminobutyrate aminotransferase) involved in the 4-aminobutyrate and glutamate degradation pathways; required for normal oxidative stress tolerance and nitrogen utilization"
Sequence
MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYEKSLGNYITDV
DGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDRPALGNFPSKDLDKILKQILK
SAPKGQDHVWSGLSGADANELAFKAAFIYYRAKQRGYDADFSEKENLSVMDNDAPGAPHL
AVLSFKRAFHGRLFASGSTTCSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDH
CLAIVEELIKTWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG
VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFNTWCGEPARMI
IAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENFQNLRGKGRGTFIAWDLPTGE
KRDLLLKKLKLNGCNVGGCAVHAVRLRPSLTFEEKHADIFIEALAKSVNEL
Download sequence
Identical sequences N1P3S6 P17649
YGR019W 4932.YGR019W YGR019W YGR019W YGR019W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]