SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR029W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR029W
Domain Number 1 Region: 83-188
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 5.23e-43
Family FAD-dependent thiol oxidase 0.0000299
Further Details:      
 
Weak hits

Sequence:  YGR029W
Domain Number - Region: 17-45
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0856
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
tissue regeneration 1.968 16.43
wound healing 1.379 6
protein folding 1.901 5.83
Cellular Component IC (bits) H-Score
intrinsic component of organelle membrane 2.09 12.51
extracellular space 1.521 9.02
Golgi membrane 1.613 4.05

Protein sequence

External link(s) Locus: YGR029W   Protein: S000003261
Sequence length 189
Comment ERV1 SGDID:S000003261, Chr VII from 543557-543642,543726-544209, Verified ORF, "Flavin-linked sulfhydryl oxidase of the mitochondrial intermembrane space (IMS), oxidizes Mia40p as part of a disulfide relay system that promotes IMS retention of imported proteins; ortholog of human hepatopoietin (ALR)"
Sequence
MKAIDKMTDNPPQEGLSGRKIIYDEDGKPCRSCNTLLDFQYVTGKISNGLKNLSSNGKLA
GTGALTGEASELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQF
LNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWE
KRWKDGWDE
Download sequence
Identical sequences A6ZV17 B3LIJ1 C8Z8S3 N1P230 P27882 W7PK80
YGR029W YGR029W YGR029W YGR029W 4932.YGR029W YGR029W YGR029W YGR029W YGR029W tr|A6ZV17|A6ZV17_YEAS7 YGR029W YGR029W SCRT_00983 YGR029W YGR029W YGR029W YGR029W YGR029W YGR029W YGR029W YGR029W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]