SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR029W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR029W
Domain Number 1 Region: 83-188
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 5.23e-43
Family FAD-dependent thiol oxidase 2.99e-05
Further Details:      
 
Weak hits

Sequence:  YGR029W
Domain Number - Region: 17-45
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0856
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.039
Further Details:      
 

Protein sequence

External link(s) Locus: YGR029W   Protein: S000003261
Sequence length 189
Comment ERV1 SGDID:S000003261, Chr VII from 543557-543642,543726-544209, Verified ORF, "Flavin-linked sulfhydryl oxidase of the mitochondrial intermembrane space (IMS), oxidizes Mia40p as part of a disulfide relay system that promotes IMS retention of imported proteins; ortholog of human hepatopoietin (ALR)"
Sequence
MKAIDKMTDNPPQEGLSGRKIIYDEDGKPCRSCNTLLDFQYVTGKISNGLKNLSSNGKLA
GTGALTGEASELMPGSRTYRKVDPPDVEQLGRSSWTLLHSVAASYPAQPTDQQKGEMKQF
LNIFSHIYPCNWCAKDFEKYIRENAPQVESREELGRWMCEAHNKVNKKLRKPKFDCNFWE
KRWKDGWDE
Download sequence
Identical sequences A6ZV17 B3LIJ1 C8Z8S3 P27882
YGR029W YGR029W YGR029W YGR029W YGR029W YGR029W YGR029W YGR029W YGR029W YGR029W 4932.YGR029W YGR029W YGR029W SCRT_00983 YGR029W YGR029W tr|A6ZV17|A6ZV17_YEAS7 YGR029W YGR029W YGR029W YGR029W

Jump to [ Top of page · Domain architecture · Domain assignment details ]