SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR031C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGR031C-A   Protein: S000028636
Sequence length 163
Comment NAG1 SGDID:S000028636, Chr VII from 547304-546813, reverse complement, Verified ORF, "Protein involved in yeast cell wall biogenesis; localizes to the cell periphery; production of Nag1p is dependent upon the presence of Slt2p and Rlm1p; null is hypersensitive to calcofluor white; overlaps the uncharacterized ORF YGR031W"
Sequence
MNSAGRVHRSRAGSRGHAAISPLTMASFSVARGIRSSNVYDDTDDELSILTFFSAVRRNR
LTSSLPPILSARCSSACFSVRIVLPLSLTISISALMYSTNSALGRKLTGAFSIQTNIEQS
CGFFRTSIMATLPPIECPIIIGPPLVFNSCFVIKCFTSSDMTS
Download sequence
Identical sequences C7GK99 C8Z8S6 Q8TGN9
YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A 4932.YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]