SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR031C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR031C-A   Protein: S000028636
Sequence length 163
Comment NAG1 SGDID:S000028636, Chr VII from 547304-546813, reverse complement, Verified ORF, "Protein involved in yeast cell wall biogenesis; localizes to the cell periphery; production of Nag1p is dependent upon the presence of Slt2p and Rlm1p; null is hypersensitive to calcofluor white; overlaps the uncharacterized ORF YGR031W"
Sequence
MNSAGRVHRSRAGSRGHAAISPLTMASFSVARGIRSSNVYDDTDDELSILTFFSAVRRNR
LTSSLPPILSARCSSACFSVRIVLPLSLTISISALMYSTNSALGRKLTGAFSIQTNIEQS
CGFFRTSIMATLPPIECPIIIGPPLVFNSCFVIKCFTSSDMTS
Download sequence
Identical sequences C7GK99 C8Z8S6 Q8TGN9
YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A 4932.YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A YGR031C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]