SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR035W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGR035W-A   Protein: S000028827
Sequence length 73
Comment YGR035W-A SGDID:S000028827, Chr VII from 557569-557790, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MLLYLYILYIALKTVSHLFFCNPCFRNLSVGDMLNPRLSLSFFTNHLLCPEAPLIIRGKG
SYSAVGNFFSRKK
Download sequence
Identical sequences G2WEC6 Q45U48
YGR035W-A 4932.YGR035W-A YGR035W-A YGR035W-A YGR035W-A YGR035W-A YGR035W-A YGR035W-A YGR035W-A YGR035W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]