SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR035W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR035W-A   Protein: S000028827
Sequence length 73
Comment YGR035W-A SGDID:S000028827, Chr VII from 557569-557790, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MLLYLYILYIALKTVSHLFFCNPCFRNLSVGDMLNPRLSLSFFTNHLLCPEAPLIIRGKG
SYSAVGNFFSRKK
Download sequence
Identical sequences G2WEC6 Q45U48
YGR035W-A YGR035W-A YGR035W-A 4932.YGR035W-A YGR035W-A YGR035W-A YGR035W-A YGR035W-A YGR035W-A YGR035W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]