SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR040W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR040W
Domain Number 1 Region: 5-322
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-95
Family Protein kinases, catalytic subunit 9.31e-08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
centrosome 1.805 14.58
spindle pole 2.218 12.59
cytosol 1.305 12.35
axon 1.502 9.91
neuron projection terminus 2.106 9.91
chromosomal part 1.478 9.28
microtubule associated complex 1.998 9.06
nuclear chromosome 1.723 8.53
cell cortex 1.621 8.28
nucleoplasm part 1.419 8.05

Protein sequence

External link(s) Locus: YGR040W   Protein: S000003272
Sequence length 368
Comment KSS1 SGDID:S000003272, Chr VII from 575402-576508, Verified ORF, "Mitogen-activated protein kinase (MAPK) involved in signal transduction pathways that control filamentous growth and pheromone response; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains"
Sequence
MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREI
KLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHV
QYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVG
FMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILE
VLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDK
RISAAEALRHPYLAMYHDPSDEPEYPPLNLDDEFWKLDNKIMRPEEEEEVPIEMLKDMLY
DELMKTME
Download sequence
Identical sequences A6ZV28 B3LII1 B5VIZ4 C7GXM6 C8Z8T6 E7KNM8 E7LUK5 E7QF07 G2WED0 H0GGH1 N1P9U9 P14681 W7PT01 W7RJW8
YGR040W YGR040W YGR040W YGR040W YGR040W YGR040W YGR040W GO.34669 YGR040W YGR040W YGR040W 4932.YGR040W YGR040W SCRT_00972 YGR040W tr|A6ZV28|A6ZV28_YEAS7 YGR040W YGR040W YGR040W YGR040W YGR040W YGR040W YGR040W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]