SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR057C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGR057C   Protein: S000003289
Sequence length 242
Comment LST7 SGDID:S000003289, Chr VII from 605505-604777, reverse complement, Verified ORF, "Protein possibly involved in a post-Golgi secretory pathway; required for the transport of nitrogen-regulated amino acid permease Gap1p from the Golgi to the cell surface"
Sequence
MSSTVISLAHFCDKHGPRIISVTQSAEKGTLGEELLVPDYPTESYCESCLLQFPEESTRS
MRCFIEDVPFITTQYSSIRYQLLNSIIKRAFSEETMIYDNMPFIFFDDLRGLNLVIGFKL
YDENARGNERRYCFILTVDSRSHDDSMKMLSEHWNFIIGGFDKMIAYIKNIHKSEFLGKN
KTVENNLETLNNNAFIGSYLRANKSKFGRNLVSLTDDKFLFVRIHKWNSFLLHTVMNENK
LP
Download sequence
Identical sequences A6ZV42 B3LIG6 N1P3V8 P53237 W7R223
YGR057C YGR057C 4932.YGR057C YGR057C YGR057C SCRT_00957 YGR057C tr|A6ZV42|A6ZV42_YEAS7 YGR057C YGR057C YGR057C YGR057C YGR057C YGR057C YGR057C

Jump to [ Top of page · Domain architecture · Domain assignment details ]