SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR057C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR057C   Protein: S000003289
Sequence length 242
Comment LST7 SGDID:S000003289, Chr VII from 605505-604777, reverse complement, Verified ORF, "Protein possibly involved in a post-Golgi secretory pathway; required for the transport of nitrogen-regulated amino acid permease Gap1p from the Golgi to the cell surface"
Sequence
MSSTVISLAHFCDKHGPRIISVTQSAEKGTLGEELLVPDYPTESYCESCLLQFPEESTRS
MRCFIEDVPFITTQYSSIRYQLLNSIIKRAFSEETMIYDNMPFIFFDDLRGLNLVIGFKL
YDENARGNERRYCFILTVDSRSHDDSMKMLSEHWNFIIGGFDKMIAYIKNIHKSEFLGKN
KTVENNLETLNNNAFIGSYLRANKSKFGRNLVSLTDDKFLFVRIHKWNSFLLHTVMNENK
LP
Download sequence
Identical sequences A6ZV42 B3LIG6 N1P3V8 P53237 W7R223
YGR057C YGR057C 4932.YGR057C YGR057C YGR057C SCRT_00957 YGR057C tr|A6ZV42|A6ZV42_YEAS7 YGR057C YGR057C YGR057C YGR057C YGR057C YGR057C YGR057C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]