SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR060W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YGR060W
Domain Number - Region: 118-187
Classification Level Classification E-value
Superfamily E2 regulatory, transactivation domain 0.0436
Family E2 regulatory, transactivation domain 0.0067
Further Details:      
 

Protein sequence

External link(s) Locus: YGR060W   Protein: S000003292
Sequence length 309
Comment ERG25 SGDID:S000003292, Chr VII from 610568-611497, Verified ORF, "C-4 methyl sterol oxidase, catalyzes the first of three steps required to remove two C-4 methyl groups from an intermediate in ergosterol biosynthesis; mutants accumulate the sterol intermediate 4,4-dimethylzymosterol"
Sequence
MSAVFNNATLSGLVQASTYSQTLQNVAHYQPQLNFMEKYWAAWYSYMNNDVLATGLMFFL
LHEFMYFFRCLPWFIIDQIPYFRRWKLQPTKIPSAKEQLYCLKSVLLSHFLVEAIPIWTF
HPMCEKLGITVEVPFPSLKTMALEIGLFFVLEDTWHYWAHRLFHYGVFYKYIHKQHHRYA
APFGLSAEYAHPAETLSLGFGTVGMPILYVMYTGKLHLFTLCVWITLRLFQAVDSHSGYD
FPWSLNKIMPFWAGAEHHDLHHHYFIGNYASSFRWWDYCLDTESGPEAKASREERMKKRA
ENNAQKKTN
Download sequence
Identical sequences A6ZV45 B3LIG3 B5VJ10 C7GXP3 E7KCV2 E7NHW1 E7QEQ9 G2WEE7 H0GGI7 P53045
YGR060W YGR060W YGR060W YGR060W YGR060W YGR060W YGR060W 354984 NYSGXRC-6162a YGR060W YGR060W 4932.YGR060W YGR060W YGR060W SCRT_00954 YGR060W YGR060W tr|A6ZV45|A6ZV45_YEAS7 YGR060W YGR060W YGR060W

Jump to [ Top of page · Domain architecture · Domain assignment details ]