SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR060W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YGR060W
Domain Number - Region: 118-187
Classification Level Classification E-value
Superfamily E2 regulatory, transactivation domain 0.0436
Family E2 regulatory, transactivation domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR060W   Protein: S000003292
Sequence length 309
Comment ERG25 SGDID:S000003292, Chr VII from 610568-611497, Verified ORF, "C-4 methyl sterol oxidase, catalyzes the first of three steps required to remove two C-4 methyl groups from an intermediate in ergosterol biosynthesis; mutants accumulate the sterol intermediate 4,4-dimethylzymosterol"
Sequence
MSAVFNNATLSGLVQASTYSQTLQNVAHYQPQLNFMEKYWAAWYSYMNNDVLATGLMFFL
LHEFMYFFRCLPWFIIDQIPYFRRWKLQPTKIPSAKEQLYCLKSVLLSHFLVEAIPIWTF
HPMCEKLGITVEVPFPSLKTMALEIGLFFVLEDTWHYWAHRLFHYGVFYKYIHKQHHRYA
APFGLSAEYAHPAETLSLGFGTVGMPILYVMYTGKLHLFTLCVWITLRLFQAVDSHSGYD
FPWSLNKIMPFWAGAEHHDLHHHYFIGNYASSFRWWDYCLDTESGPEAKASREERMKKRA
ENNAQKKTN
Download sequence
Identical sequences A6ZV45 B3LIG3 B5VJ10 C7GXP3 E7KCV2 E7NHW1 E7QEQ9 G2WEE7 H0GGI7 P53045 W7PU69
YGR060W YGR060W YGR060W YGR060W YGR060W YGR060W YGR060W 354984 NYSGXRC-6162a YGR060W YGR060W 4932.YGR060W YGR060W YGR060W SCRT_00954 YGR060W YGR060W tr|A6ZV45|A6ZV45_YEAS7 YGR060W YGR060W YGR060W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]