SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGR085C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR085C
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily RL5-like 7.53e-58
Family Ribosomal protein L5 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribosomal subunit 1.948 14.01
cytosolic part 1.678 11.39
cytosolic ribosome 2.062 10.42
intracellular ribonucleoprotein complex 1.323 9.44
Molecular Function IC (bits) H-Score
structural constituent of ribosome 1.965 23.65

Protein sequence

External link(s) Locus: YGR085C   Protein: S000003317
Sequence length 174
Comment RPL11B SGDID:S000003317, Chr VII from 648911-648387, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl11Ap; involved in ribosomal assembly; depletion causes degradation of proteins and RNA of the 60S subunit; has similarity to E. coli L5 and rat L11"
Sequence
MSTKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIR
RNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSI
GIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTVSWFKQKYDADVLDK
Download sequence
Identical sequences A6ZV67 B3LIE1 B5VJ29 C8Z8X9 E7KNQ5 E7LUQ2 E7NHX5 E7QES3 G2WEG9 H0H2G4 N1P3L3 Q3E757
YGR085C ORFP:8112 YGR085C YGR085C YGR085C YGR085C ORFP:8536 YGR085C YGR085C YGR085C YGR085C YGR085C SCRT_00932 YGR085C YGR085C 4932.YGR085C YGR085C YGR085C tr|A6ZV67|A6ZV67_YEAS7 YGR085C YGR085C YGR085C YGR085c___KOG0397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]