SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR085C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR085C
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily RL5-like 7.53e-58
Family Ribosomal protein L5 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
translation 1.518 19.49
protein localization to organelle 1.46 8.08
Molecular Function IC (bits) H-Score
structural constituent of ribosome 1.984 21.65
Cellular Component IC (bits) H-Score
ribosomal subunit 2.011 12.43
cytosol 1.301 10.37
ribonucleoprotein complex 1.414 8.82
cytosolic ribosome 2.218 3.63

Protein sequence

External link(s) Locus: YGR085C   Protein: S000003317
Sequence length 174
Comment RPL11B SGDID:S000003317, Chr VII from 648911-648387, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl11Ap; involved in ribosomal assembly; depletion causes degradation of proteins and RNA of the 60S subunit; has similarity to E. coli L5 and rat L11"
Sequence
MSTKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIR
RNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSI
GIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTVSWFKQKYDADVLDK
Download sequence
Identical sequences A6ZV67 B3LIE1 B5VJ29 C8Z8X9 E7KNQ5 E7LUQ2 E7NHX5 E7QES3 G2WEG9 H0H2G4 N1P3L3 Q3E757
YGR085C YGR085C YGR085C YGR085C YGR085C YGR085C YGR085C YGR085C YGR085C YGR085C SCRT_00932 YGR085C tr|A6ZV67|A6ZV67_YEAS7 YGR085C YGR085C YGR085C YGR085C YGR085c___KOG0397 YGR085C ORFP:8112 YGR085C 4932.YGR085C ORFP:8536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]