SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR085C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR085C
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily RL5-like 7.53e-58
Family Ribosomal protein L5 2.7e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YGR085C   Protein: S000003317
Sequence length 174
Comment RPL11B SGDID:S000003317, Chr VII from 648911-648387, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl11Ap; involved in ribosomal assembly; depletion causes degradation of proteins and RNA of the 60S subunit; has similarity to E. coli L5 and rat L11"
Sequence
MSTKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIR
RNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSI
GIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTVSWFKQKYDADVLDK
Download sequence
Identical sequences A6ZV67 B3LIE1 B5VJ29 C8Z8X9 E7KNQ5 E7LUQ2 E7NHX5 E7QES3 G2WEG9 H0H2G4 Q3E757
YGR085C YGR085C ORFP:8112 YGR085C ORFP:8536 YGR085C YGR085C YGR085C YGR085C YGR085C YGR085C YGR085C YGR085C 4932.YGR085C YGR085C SCRT_00932 YGR085C tr|A6ZV67|A6ZV67_YEAS7 YGR085C YGR085C YGR085C YGR085c___KOG0397 YGR085C

Jump to [ Top of page · Domain architecture · Domain assignment details ]