SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR103W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR103W
Domain Number 1 Region: 358-451
Classification Level Classification E-value
Superfamily BRCT domain 5.23e-16
Family DNA ligase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribonucleoprotein complex 1.414 22.48
ubiquitin ligase complex 1.917 7.26
SWI/SNF superfamily-type complex 2.178 7.14
transferase complex 1.423 6.89
DNA repair complex 2.141 6.17
chromosomal part 1.477 5.8
replication fork 2.208 5.56
nuclear chromosome 1.73 4.84
condensed chromosome 2.187 4.84
microtubule cytoskeleton 1.341 4.77

Protein sequence

External link(s) Locus: YGR103W   Protein: S000003335
Sequence length 605
Comment NOP7 SGDID:S000003335, Chr VII from 695421-697238, Verified ORF, "Nucleolar protein involved in rRNA processing and 60S ribosomal subunit biogenesis; constituent of several different pre-ribosomal particles; required for exit from G0 and the initiation of cell proliferation"
Sequence
MRIKKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKKKANKGSTAPT
TFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVSSAKRLEENRDSYTLDHIIKE
RYPSFPDAIRDIDDALNMLFLFSNLPSTNQVSSKIINDAQKICNQWLAYVAKERLVRKVF
VSIKGVYYQANIKGEEVRWLVPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDS
GLIYPPKLDLKKDKIISGLSSYILESRQEDSLLKLDPTEIEEDVKVESLDASTLKSALNA
DEANTDETEKEEEQEKKQEKEQEKEQNEETELDTFEDNNKNKGDILIQPSKYDSPVASLF
SAFVFYVSREVPIDILEFLILSCGGNVISEAAMDQIENKKDIDMSKVTHQIVDRPVLKNK
VAGRTYIQPQWIFDCINKGELVPANKYLPGEALPPHLSPWGDAIGYDPTAPVEEGEEEES
ESESESEDQVEEEDQEVVAGEEDDDDDEELQAQKELELEAQGIKYSETSEADKDVNKSKN
KKRKVDEEEEEKKLKMIMMSNKQKKLYKKMKYSNAKKEEQAENLKKKKKQIAKQKAKLNK
LDSKK
Download sequence
Identical sequences A6ZV85 B3LIC3 C7GWW0 C8Z8Z6 P53261 W7PKE5 W7RJZ4
YGR103W Pf-sce:YGR103W YGR103W YGR103W sp|A6ZV85|PESC_YEAS7 YGR103W SCRT_00914 YGR103W YGR103W 4932.YGR103W YGR103w___KOG2481 YGR103W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]