SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR103W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR103W
Domain Number 1 Region: 358-451
Classification Level Classification E-value
Superfamily BRCT domain 5.23e-16
Family DNA ligase 0.018
Further Details:      
 

Protein sequence

External link(s) Locus: YGR103W   Protein: S000003335
Sequence length 605
Comment NOP7 SGDID:S000003335, Chr VII from 695421-697238, Verified ORF, "Nucleolar protein involved in rRNA processing and 60S ribosomal subunit biogenesis; constituent of several different pre-ribosomal particles; required for exit from G0 and the initiation of cell proliferation"
Sequence
MRIKKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKKKANKGSTAPT
TFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVSSAKRLEENRDSYTLDHIIKE
RYPSFPDAIRDIDDALNMLFLFSNLPSTNQVSSKIINDAQKICNQWLAYVAKERLVRKVF
VSIKGVYYQANIKGEEVRWLVPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDS
GLIYPPKLDLKKDKIISGLSSYILESRQEDSLLKLDPTEIEEDVKVESLDASTLKSALNA
DEANTDETEKEEEQEKKQEKEQEKEQNEETELDTFEDNNKNKGDILIQPSKYDSPVASLF
SAFVFYVSREVPIDILEFLILSCGGNVISEAAMDQIENKKDIDMSKVTHQIVDRPVLKNK
VAGRTYIQPQWIFDCINKGELVPANKYLPGEALPPHLSPWGDAIGYDPTAPVEEGEEEES
ESESESEDQVEEEDQEVVAGEEDDDDDEELQAQKELELEAQGIKYSETSEADKDVNKSKN
KKRKVDEEEEEKKLKMIMMSNKQKKLYKKMKYSNAKKEEQAENLKKKKKQIAKQKAKLNK
LDSKK
Download sequence
Identical sequences A6ZV85 B3LIC3 C7GWW0 C8Z8Z6 P53261 W7PKE5 W7RJZ4
YGR103W 4932.YGR103W YGR103W YGR103W SCRT_00914 YGR103W YGR103W sp|A6ZV85|PESC_YEAS7 YGR103w___KOG2481 Pf-sce:YGR103W YGR103W YGR103W

Jump to [ Top of page · Domain architecture · Domain assignment details ]