SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR109W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR109W-A
Domain Number 1 Region: 248-285
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 9e-06
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Protein sequence

External link(s) Locus: YGR109W-A   Protein: S000007346
Sequence length 290
Comment YGR109W-A SGDID:S000007346, Chr VII from 707614-708486, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNGYVHTVRTRRS
YNKPMSNHRNRRNNNPSREECIKNRLCFYCKKEGHRLNECRARKASSNRS
Download sequence
Identical sequences Q12173
YGR109W-A 4932.YGR109W-A YGR109W-A 354941 YGR109W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]