SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGR109W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR109W-A
Domain Number 1 Region: 248-285
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000009
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.424 32.44
cytoplasmic ribonucleoprotein granule 1.909 14.2
intracellular ribonucleoprotein complex 1.323 9.96
nuclear body 1.842 9.32
spliceosomal complex 1.903 5.07
Biological Process IC (bits) H-Score
ncRNA metabolic process 1.499 51.99
ncRNA processing 1.821 42.93
mitochondrion organization 1.534 29.83
mesenchyme development 1.586 20.51
stem cell differentiation 1.644 20.51
cell fate commitment 1.416 20.51
neural crest cell differentiation 1.845 20.51
gene silencing 1.966 11.8
regulation of mRNA metabolic process 1.982 8.98
mRNA catabolic process 1.993 8.91
Molecular Function IC (bits) H-Score
protein kinase binding 1.503 24.72
single-stranded DNA binding 2.194 8.9
DNA polymerase activity 2.117 8.57
nucleotidyltransferase activity 1.523 7.78
RNA binding 1.279 7.1
nuclease activity 1.592 5.14

Protein sequence

External link(s) Locus: YGR109W-A   Protein: S000007346
Sequence length 290
Comment YGR109W-A SGDID:S000007346, Chr VII from 707614-708486, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNGYVHTVRTRRS
YNKPMSNHRNRRNNNPSREECIKNRLCFYCKKEGHRLNECRARKASSNRS
Download sequence
Identical sequences Q12173
4932.YGR109W-A YGR109W-A 354941 YGR109W-A YGR109W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]