SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR109W-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR109W-B
Domain Number 1 Region: 583-994
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.11e-141
Family Reverse transcriptase 6.8e-05
Further Details:      
 
Domain Number 2 Region: 1161-1318
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.4e-38
Family Retroviral integrase, catalytic domain 0.021
Further Details:      
 
Domain Number 3 Region: 320-418
Classification Level Classification E-value
Superfamily Acid proteases 1.43e-07
Family Retroviral protease (retropepsin) 0.05
Further Details:      
 
Domain Number 4 Region: 248-287
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 5.41e-06
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Protein sequence

External link(s) Locus: YGR109W-B   Protein: S000007347
Sequence length 1547
Comment YGR109W-B SGDID:S000007347, Chr VII from 707614-708463,708465-712258, transposable_element_gene, "Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes"
Sequence
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNGYVHTVRTRRS
YNKPMSNHRNRRNNNPSREECIKNRLCFYCKKEGHRLNECRARRRVLTDLELESKDQQTP
FIKTLPIVHYIAIPEMDNTAEKTIKIQNTKVKTLFDSGSPTSFIRRDIVELLKYEIYETP
PLRFRGFVATKSAVTSEAVTIDLKINDLHITLAAYILDNMDYQLLIGNPILRRYPKILHT
VLNTRESPDSLKPKTYRSETVNNVRTYSAGNRGNPRNIKLSFAPTILEATDPKSAGNRGD
SRTKTLSLATTTPAAIDPLTTLDNPGSTQSTFAQFPIPEEASILEEDGKYSNVVSTIQSV
EPNATDHSNKDTFCTLPVWLQQKYREIIRNDLPPRPADINNIPVKHDIEIKPGARLPRLQ
PYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATI
SDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPF
GLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKK
KKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPN
CSKIAQPIQLFICDKSQWTEKQDKAIDKLKDALCNSPVLVPFNNKANYRLTTDASKDGIG
AVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRT
DHISLLSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAISRAVYTITPETSRP
IDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPEDMSAFRSYQKKLELSETFRKNYSLED
EMIYYQDRLVVPIKQQNAVMRLYHDHTLFGGHFGVTVTLAKISPIYYWPKLQHSIIQYIR
TCVQCQLIKSHRPRLHGLLQPLPIAEGRWLDISMDFVTGLPPTSNNLNMILVVVDRFSKR
AHFIATRKTLDATQLIDLLFRYIFSYHGFPRTITSDRDVRMTADKYQELTKRLGIKSTMS
SANHPQTDGQSERTIQTLNRLLRAYASTNIQNWHVYLPQIEFVYNSTPTRTLGKSPFEID
LGYLPNTPAIKSDDEVNARSFTAVELAKHLKALTIQTKEQLEHAQIEMETNNNQRRKPLL
LNIGDHVLVHRDAYFKKGAYMKVQQIYVGPFRVVKKINDNAYELDLNSHKKKHRVINVQF
LKKFVYRPDAYPKNKPISSTERIKRAHEVTALIGIDTTHKTYLCHMQDVDPTLSVEYSEA
EFCQIPERTRRSILANFRQLYETQDNPEREEDVVSQNEICQYDNTSP
Download sequence
Identical sequences YGR109W-B 4932.YGR109W-B YGR109W-B YGR109W-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]