SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGR109W-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR109W-B
Domain Number 1 Region: 583-994
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.11e-141
Family Reverse transcriptase 0.000068
Further Details:      
 
Domain Number 2 Region: 1161-1318
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.4e-38
Family Retroviral integrase, catalytic domain 0.021
Further Details:      
 
Domain Number 3 Region: 320-418
Classification Level Classification E-value
Superfamily Acid proteases 0.000000143
Family Retroviral protease (retropepsin) 0.05
Further Details:      
 
Domain Number 4 Region: 248-287
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000541
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
nuclease activity 1.579 108.37
DNA polymerase activity 2.118 105.04
endopeptidase activity 1.576 59.24
nucleotidyltransferase activity 1.506 53.57
exoribonuclease activity 2.129 24.97
protein kinase binding 1.481 24.78
lyase activity 1.395 24.38
endonuclease activity 1.983 18.69
miRNA binding 2.226 10.93
single-stranded RNA binding 2.032 6.96
Cellular Component IC (bits) H-Score
secretory vesicle 1.491 57.68
transferase complex 1.334 36.82
replication fork 2.17 25.56
cytoplasmic ribonucleoprotein granule 1.891 17.8
endocytic vesicle 1.514 16.05
cytoplasmic vesicle part 1.377 15.13
endosome 1.317 15.13
late endosome 1.808 14.93
intracellular ribonucleoprotein complex 1.329 13.64
spliceosomal snRNP complex 2.016 11.6

Protein sequence

External link(s) Locus: YGR109W-B   Protein: S000007347
Sequence length 1547
Comment YGR109W-B SGDID:S000007347, Chr VII from 707614-708463,708465-712258, transposable_element_gene, "Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes"
Sequence
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNGYVHTVRTRRS
YNKPMSNHRNRRNNNPSREECIKNRLCFYCKKEGHRLNECRARRRVLTDLELESKDQQTP
FIKTLPIVHYIAIPEMDNTAEKTIKIQNTKVKTLFDSGSPTSFIRRDIVELLKYEIYETP
PLRFRGFVATKSAVTSEAVTIDLKINDLHITLAAYILDNMDYQLLIGNPILRRYPKILHT
VLNTRESPDSLKPKTYRSETVNNVRTYSAGNRGNPRNIKLSFAPTILEATDPKSAGNRGD
SRTKTLSLATTTPAAIDPLTTLDNPGSTQSTFAQFPIPEEASILEEDGKYSNVVSTIQSV
EPNATDHSNKDTFCTLPVWLQQKYREIIRNDLPPRPADINNIPVKHDIEIKPGARLPRLQ
PYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATI
SDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPF
GLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKK
KKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPN
CSKIAQPIQLFICDKSQWTEKQDKAIDKLKDALCNSPVLVPFNNKANYRLTTDASKDGIG
AVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRT
DHISLLSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAISRAVYTITPETSRP
IDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPEDMSAFRSYQKKLELSETFRKNYSLED
EMIYYQDRLVVPIKQQNAVMRLYHDHTLFGGHFGVTVTLAKISPIYYWPKLQHSIIQYIR
TCVQCQLIKSHRPRLHGLLQPLPIAEGRWLDISMDFVTGLPPTSNNLNMILVVVDRFSKR
AHFIATRKTLDATQLIDLLFRYIFSYHGFPRTITSDRDVRMTADKYQELTKRLGIKSTMS
SANHPQTDGQSERTIQTLNRLLRAYASTNIQNWHVYLPQIEFVYNSTPTRTLGKSPFEID
LGYLPNTPAIKSDDEVNARSFTAVELAKHLKALTIQTKEQLEHAQIEMETNNNQRRKPLL
LNIGDHVLVHRDAYFKKGAYMKVQQIYVGPFRVVKKINDNAYELDLNSHKKKHRVINVQF
LKKFVYRPDAYPKNKPISSTERIKRAHEVTALIGIDTTHKTYLCHMQDVDPTLSVEYSEA
EFCQIPERTRRSILANFRQLYETQDNPEREEDVVSQNEICQYDNTSP
Download sequence
Identical sequences YGR109W-B YGR109W-B 4932.YGR109W-B YGR109W-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]