SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR109W-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR109W-B
Domain Number 1 Region: 583-994
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.11e-141
Family Reverse transcriptase 6.8e-05
Further Details:      
 
Domain Number 2 Region: 1161-1318
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.4e-38
Family Retroviral integrase, catalytic domain 0.021
Further Details:      
 
Domain Number 3 Region: 320-418
Classification Level Classification E-value
Superfamily Acid proteases 1.43e-07
Family Retroviral protease (retropepsin) 0.05
Further Details:      
 
Domain Number 4 Region: 248-287
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 5.41e-06
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
replication fork 2.198 26.98
ribonucleoprotein granule 1.999 22.37
vacuole 1.428 19.62
endocytic vesicle 1.435 15.58
ribonucleoprotein complex 1.418 15.25
small nuclear ribonucleoprotein complex 2.005 13.11
exosome (RNase complex) 2.218 10.37
external encapsulating structure 1.635 9.56
mitochondrial matrix 1.707 9.31
nucleoplasm part 1.418 5.59

Protein sequence

External link(s) Locus: YGR109W-B   Protein: S000007347
Sequence length 1547
Comment YGR109W-B SGDID:S000007347, Chr VII from 707614-708463,708465-712258, transposable_element_gene, "Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes"
Sequence
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNGYVHTVRTRRS
YNKPMSNHRNRRNNNPSREECIKNRLCFYCKKEGHRLNECRARRRVLTDLELESKDQQTP
FIKTLPIVHYIAIPEMDNTAEKTIKIQNTKVKTLFDSGSPTSFIRRDIVELLKYEIYETP
PLRFRGFVATKSAVTSEAVTIDLKINDLHITLAAYILDNMDYQLLIGNPILRRYPKILHT
VLNTRESPDSLKPKTYRSETVNNVRTYSAGNRGNPRNIKLSFAPTILEATDPKSAGNRGD
SRTKTLSLATTTPAAIDPLTTLDNPGSTQSTFAQFPIPEEASILEEDGKYSNVVSTIQSV
EPNATDHSNKDTFCTLPVWLQQKYREIIRNDLPPRPADINNIPVKHDIEIKPGARLPRLQ
PYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATI
SDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPF
GLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKK
KKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPN
CSKIAQPIQLFICDKSQWTEKQDKAIDKLKDALCNSPVLVPFNNKANYRLTTDASKDGIG
AVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRT
DHISLLSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAISRAVYTITPETSRP
IDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPEDMSAFRSYQKKLELSETFRKNYSLED
EMIYYQDRLVVPIKQQNAVMRLYHDHTLFGGHFGVTVTLAKISPIYYWPKLQHSIIQYIR
TCVQCQLIKSHRPRLHGLLQPLPIAEGRWLDISMDFVTGLPPTSNNLNMILVVVDRFSKR
AHFIATRKTLDATQLIDLLFRYIFSYHGFPRTITSDRDVRMTADKYQELTKRLGIKSTMS
SANHPQTDGQSERTIQTLNRLLRAYASTNIQNWHVYLPQIEFVYNSTPTRTLGKSPFEID
LGYLPNTPAIKSDDEVNARSFTAVELAKHLKALTIQTKEQLEHAQIEMETNNNQRRKPLL
LNIGDHVLVHRDAYFKKGAYMKVQQIYVGPFRVVKKINDNAYELDLNSHKKKHRVINVQF
LKKFVYRPDAYPKNKPISSTERIKRAHEVTALIGIDTTHKTYLCHMQDVDPTLSVEYSEA
EFCQIPERTRRSILANFRQLYETQDNPEREEDVVSQNEICQYDNTSP
Download sequence
Identical sequences YGR109W-B 4932.YGR109W-B YGR109W-B YGR109W-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]