SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR114C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR114C   Protein: S000003346
Sequence length 129
Comment YGR114C SGDID:S000003346, Chr VII from 720658-720269, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; open reading frame overlaps 5' end of the essential gene SPT6"
Sequence
MFSSFFGNTCSWVFIFIIIVDNEAFLHFSCLIFVFINIFVFLRGVKDIFSFFFLTRRFSF
IVVIYYFFLVPRDQLRISRLFHKRQILCKDSRQLMTCSLGLFFKAQINIFLPPFALTVVQ
FLVNLVCHT
Download sequence
Identical sequences C8Z906 P53268
4113 YGR114C 4932.YGR114C YGR114C YGR114C YGR114C YGR114C YGR114C YGR114C YGR114C YGR114C YGR114C YGR114C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]