SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR114C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGR114C   Protein: S000003346
Sequence length 129
Comment YGR114C SGDID:S000003346, Chr VII from 720658-720269, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; open reading frame overlaps 5' end of the essential gene SPT6"
Sequence
MFSSFFGNTCSWVFIFIIIVDNEAFLHFSCLIFVFINIFVFLRGVKDIFSFFFLTRRFSF
IVVIYYFFLVPRDQLRISRLFHKRQILCKDSRQLMTCSLGLFFKAQINIFLPPFALTVVQ
FLVNLVCHT
Download sequence
Identical sequences C8Z906 P53268
YGR114C YGR114C 4932.YGR114C YGR114C YGR114C YGR114C YGR114C YGR114C YGR114C YGR114C YGR114C 4113 YGR114C

Jump to [ Top of page · Domain architecture · Domain assignment details ]