SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YGR118W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR118W
Domain Number 1 Region: 22-143
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.14e-35
Family Cold shock DNA-binding domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 55.13
replication fork 2.198 34.31
nucleoplasm part 1.418 33.7
nuclear chromosome 1.72 24.48
chromosomal part 1.477 22.68
ribonucleoprotein complex 1.418 20.29
ribosomal subunit 2.011 19.49
DNA-directed RNA polymerase complex 2.005 12.25
ribonucleoprotein granule 1.999 10.35
cytosol 1.307 7.62
Biological Process IC (bits) H-Score
DNA-dependent DNA replication 1.996 68.7
DNA duplex unwinding 1.979 46.97
double-strand break repair 1.887 44.68
tRNA aminoacylation 2.002 39.07
translation 1.521 35.23
telomere organization 2.104 26.38
RNA processing 1.458 21.38
mRNA metabolic process 1.627 21.38
RNA 3'-end processing 2.027 21.38
regulation of DNA replication 2.144 20.24

Protein sequence

External link(s) Locus: YGR118W   Protein: S000003350
Sequence length 145
Comment RPS23A SGDID:S000003350, Chr VII from 726978-727042,727363-727735, Verified ORF, "Ribosomal protein 28 (rp28) of the small (40S) ribosomal subunit, required for translational accuracy; nearly identical to Rps23Bp and similar to E. coli S12 and rat S23 ribosomal proteins; deletion of both RPS23A and RPS23B is lethal"
Sequence
MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIE
SKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGV
RFKVVKVSGVSLLALWKEKKEKPRS
Download sequence
Identical sequences A6ZUD1 B3LIB1 C8ZJF4 G2WEK0 G8ZX19 H2ANL8 N1P5W3 P0CX29 P0CX30 P0CY39 P0CY40 Q6FLA8 Q6YIA3 W7PJ85 W7QUI5
YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W 1vw9.Y 1vwv.Y 1vxw.X 1vxz.X 3izb.L 3o2z.P 3o30.P 3u5c.X 3u5g.X 4byl.X 4byt.X YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YPR132W 4932.YGR118W 4932.YPR132W YGR118W YPR132W YGR118W YPR132W YPR132W tr|A6ZUD1|A6ZUD1_YEAS7 YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W gnl|GLV|CAGL0L04840g YGR118W YPR132W SCRT_00901 SCRT_02607 YGR118W YGR118W YPR132W YPR132W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]