SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGR118W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR118W
Domain Number 1 Region: 22-143
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.14e-35
Family Cold shock DNA-binding domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.182 53.06
replication fork 2.213 37.25
nucleoplasm part 1.369 33.64
chromosomal region 1.996 30.26
protein-DNA complex 1.923 25.92
aminoacyl-tRNA synthetase multienzyme complex 2.213 25.16
nuclear chromosome part 1.842 24
ribosomal subunit 1.983 22.4
chromosomal part 1.512 22.28
intracellular ribonucleoprotein complex 1.368 20.13

Protein sequence

External link(s) Locus: YGR118W   Protein: S000003350
Sequence length 145
Comment RPS23A SGDID:S000003350, Chr VII from 726978-727042,727363-727735, Verified ORF, "Ribosomal protein 28 (rp28) of the small (40S) ribosomal subunit, required for translational accuracy; nearly identical to Rps23Bp and similar to E. coli S12 and rat S23 ribosomal proteins; deletion of both RPS23A and RPS23B is lethal"
Sequence
MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIE
SKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGV
RFKVVKVSGVSLLALWKEKKEKPRS
Download sequence
Identical sequences A0A0L8RJG3 A0A0L8VQ55 A0A0W0DA40 A6ZUD1 B3LIB1 C8ZJF4 G2WEK0 G8ZX19 H2ANL8 N1P5W3 P0CX29 P0CX30 P0CY39 P0CY40 Q6FLA8 Q6YIA3
SCRT_00901 SCRT_02607 YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YPR132W YGR118W YPR132W YGR118W YPR132W YGR118W YPR132W YPR132W YPR132W 4932.YGR118W 4932.YPR132W tr|A6ZUD1|A6ZUD1_YEAS7 YPR132W gnl|GLV|CAGL0L04840g YGR118W YPR132W 000141484|e3izbL1|2.1.1.373|L:1-145 001436100|e4v6iAL1|2.1.1.373|AL:1-145 YGR118W YPR132W 3j6x.23 3j6y.23 3j77.23 3j78.23 4v6i.AL 4v7r.AP 4v7r.CP 4v88.AX 4v88.CX 4v8y.AX 4v8z.AX 5juo.UB 5jup.UB 5jus.UB 5jut.UB 5juu.UB 5ll6.c 5mc6.c 5tzs.r 5wyj.SY 5wyk.SY YGR118W YPR132W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]