SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR135W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR135W
Domain Number 1 Region: 4-249
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.46e-77
Family Proteasome subunits 7.26e-10
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
external side of plasma membrane 1.922 22.25
cytosol 1.305 13.2
ribonucleoprotein complex 1.415 6.89
extracellular organelle 1.592 4.91
ribonucleoprotein granule 1.998 4.32

Protein sequence

External link(s) Locus: YGR135W   Protein: S000003367
Sequence length 258
Comment PRE9 SGDID:S000003367, Chr VII from 761397-762173, Verified ORF, "Alpha 3 subunit of the 20S proteasome, the only nonessential 20S subunit; may be replaced by the alpha 4 subunit (Pre6p) under stress conditions to create a more active proteasomal isoform"
Sequence
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV
KTGITKKDEDEEADEDMK
Download sequence
Identical sequences A6ZUE9 B3LI93 B5VJ80 C7GUG0 E7NI06 E7Q453 E7QF45 G2WEL7 N1P9W9 P23638 W7PUE0 W7RBC6
YGR135W 2zcyB YGR135W YGR135W YGR135W YGR135W YGR135W YGR135W YGR135W YGR135W YGR135W 4932.YGR135W YGR135W SCRT_00883 YGR135W YGR135W YGR135W tr|A6ZUE9|A6ZUE9_YEAS7 1z7q.C 1z7q.Q 2zcy.B 2zcy.P 3bdm.B 3bdm.P 3nzj.B 3nzj.P 3nzw.B 3nzw.P 3nzx.B 3nzx.P 3un4.B 3un4.P 3un8.B 3un8.P 4b4t.C 4bgr.C 4c0v.C 4cr2.C 4cr3.C 4cr4.C 4g4s.C 4inr.B 4inr.P 4int.B 4int.P 4inu.B 4inu.P 4j70.B 4j70.P 4jsq.B 4jsq.P 4jsu.B 4jsu.P 4jt0.B 4jt0.P 4ltc.B 4ltc.P 4nnn.B 4nnn.P 4nnw.B 4nnw.P 4no1.B 4no1.P 4no6.B 4no6.P 4no8.B 4no8.P 4no9.B 4no9.P 4q1s.B 4q1s.P 4qby.B 4qby.P 4qlq.B 4qlq.P 4qls.B 4qls.P 4qlt.B 4qlt.P 4qlu.B 4qlu.P 4qlv.B 4qlv.P 4r02.B 4r02.P YGR135W YGR135W YGR135W YGR135W YGR135W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]