SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR145W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR145W
Domain Number 1 Region: 9-98,131-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.99e-27
Family WD40-repeat 0.015
Further Details:      
 

Protein sequence

External link(s) Locus: YGR145W   Protein: S000003377
Sequence length 707
Comment ENP2 SGDID:S000003377, Chr VII from 781772-783895, Verified ORF, "Essential nucleolar protein of unknown function; contains WD repeats, interacts with Mpp10p and Bfr2p, and has homology to Spb1p"
Sequence
MVLKSTSANDVSVYQVSGTNVSRSLPDWIAKKRKRQLKNDLEYQNRVELIQDFEFSEASN
KIKVSRDGQYCMATGTYKPQIHVYDFANLSLKFDRHTDAENVDFTILSDDWTKSVHLQND
RSIQFQNKGGLHYTTRIPKFGRSLVYNKVNCDLYVGASGNELYRLNLEKGRFLNPFKLDT
EGVNHVSINEVNGLLAAGTETNVVEFWDPRSRSRVSKLYLENNIDNRPFQVTTTSFRNDG
LTFACGTSNGYSYIYDLRTSEPSIIKDQGYGFDIKKIIWLDNVGTENKIVTCDKRIAKIW
DRLDGKAYASMEPSVDINDIEHVPGTGMFFTANESIPMHTYYIPSLGPSPRWCSFLDSIT
EELEEKPSDTVYSNYRFITRDDVKKLNLTHLVGSRVLRAYMHGFFINTELYDKVSLIANP
DAYKDEREREIRRRIEKERESRIRSSGAVQKPKIKVNKTLVDKLSQKRGDKVAGKVLTDD
RFKEMFEDEEFQVDEDDYDFKQLNPVKSIKETEEGAAKRIRALTAAEESDEERIAMKDGR
GHYDYEDEESDEEESDDETNQKSNKEELSEKDLRKMEKQKALIERRKKEKEQSERFMNEM
KAGTSTSTQRDESAHVTFGEQVGELLEVENGKKSNESILRRNQRGEAELTFIPQRKSKKD
GNYKSRRHDNSSDEEGIEENGNKKDNGRSKPRFENRRRASKNAFRGM
Download sequence
Identical sequences YGR145W 4932.YGR145W YGR145w___KOG2321

Jump to [ Top of page · Domain architecture · Domain assignment details ]