SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YGR145W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR145W
Domain Number 1 Region: 9-98,131-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.99e-27
Family WD40-repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.44
nucleolus 1.651 36.87
methyltransferase complex 2.218 18.64
cilium 1.61 16.6
nucleoplasm part 1.419 11.44
transcription factor complex 1.881 11.44
cytoplasmic vesicle part 1.737 10.36
cytoplasmic vesicle membrane 1.917 10.36
SWI/SNF superfamily-type complex 2.177 9.97
DNA-directed RNA polymerase complex 2.004 7.97

Protein sequence

External link(s) Locus: YGR145W   Protein: S000003377
Sequence length 707
Comment ENP2 SGDID:S000003377, Chr VII from 781772-783895, Verified ORF, "Essential nucleolar protein of unknown function; contains WD repeats, interacts with Mpp10p and Bfr2p, and has homology to Spb1p"
Sequence
MVLKSTSANDVSVYQVSGTNVSRSLPDWIAKKRKRQLKNDLEYQNRVELIQDFEFSEASN
KIKVSRDGQYCMATGTYKPQIHVYDFANLSLKFDRHTDAENVDFTILSDDWTKSVHLQND
RSIQFQNKGGLHYTTRIPKFGRSLVYNKVNCDLYVGASGNELYRLNLEKGRFLNPFKLDT
EGVNHVSINEVNGLLAAGTETNVVEFWDPRSRSRVSKLYLENNIDNRPFQVTTTSFRNDG
LTFACGTSNGYSYIYDLRTSEPSIIKDQGYGFDIKKIIWLDNVGTENKIVTCDKRIAKIW
DRLDGKAYASMEPSVDINDIEHVPGTGMFFTANESIPMHTYYIPSLGPSPRWCSFLDSIT
EELEEKPSDTVYSNYRFITRDDVKKLNLTHLVGSRVLRAYMHGFFINTELYDKVSLIANP
DAYKDEREREIRRRIEKERESRIRSSGAVQKPKIKVNKTLVDKLSQKRGDKVAGKVLTDD
RFKEMFEDEEFQVDEDDYDFKQLNPVKSIKETEEGAAKRIRALTAAEESDEERIAMKDGR
GHYDYEDEESDEEESDDETNQKSNKEELSEKDLRKMEKQKALIERRKKEKEQSERFMNEM
KAGTSTSTQRDESAHVTFGEQVGELLEVENGKKSNESILRRNQRGEAELTFIPQRKSKKD
GNYKSRRHDNSSDEEGIEENGNKKDNGRSKPRFENRRRASKNAFRGM
Download sequence
Identical sequences YGR145W 4932.YGR145W YGR145w___KOG2321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]