SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR145W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR145W
Domain Number 1 Region: 9-98,131-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.99e-27
Family WD40-repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 41.05
nucleolus 1.641 36.88
methyltransferase complex 2.218 18.65
cilium 1.573 18.45
transcription factor complex 1.912 12.5
chromosomal part 1.477 12.4
cytoplasmic vesicle part 1.73 10.22
cytoplasmic vesicle membrane 1.912 10.22
SWI/SNF superfamily-type complex 2.178 9.97
ciliary part 1.844 9.85

Protein sequence

External link(s) Locus: YGR145W   Protein: S000003377
Sequence length 707
Comment ENP2 SGDID:S000003377, Chr VII from 781772-783895, Verified ORF, "Essential nucleolar protein of unknown function; contains WD repeats, interacts with Mpp10p and Bfr2p, and has homology to Spb1p"
Sequence
MVLKSTSANDVSVYQVSGTNVSRSLPDWIAKKRKRQLKNDLEYQNRVELIQDFEFSEASN
KIKVSRDGQYCMATGTYKPQIHVYDFANLSLKFDRHTDAENVDFTILSDDWTKSVHLQND
RSIQFQNKGGLHYTTRIPKFGRSLVYNKVNCDLYVGASGNELYRLNLEKGRFLNPFKLDT
EGVNHVSINEVNGLLAAGTETNVVEFWDPRSRSRVSKLYLENNIDNRPFQVTTTSFRNDG
LTFACGTSNGYSYIYDLRTSEPSIIKDQGYGFDIKKIIWLDNVGTENKIVTCDKRIAKIW
DRLDGKAYASMEPSVDINDIEHVPGTGMFFTANESIPMHTYYIPSLGPSPRWCSFLDSIT
EELEEKPSDTVYSNYRFITRDDVKKLNLTHLVGSRVLRAYMHGFFINTELYDKVSLIANP
DAYKDEREREIRRRIEKERESRIRSSGAVQKPKIKVNKTLVDKLSQKRGDKVAGKVLTDD
RFKEMFEDEEFQVDEDDYDFKQLNPVKSIKETEEGAAKRIRALTAAEESDEERIAMKDGR
GHYDYEDEESDEEESDDETNQKSNKEELSEKDLRKMEKQKALIERRKKEKEQSERFMNEM
KAGTSTSTQRDESAHVTFGEQVGELLEVENGKKSNESILRRNQRGEAELTFIPQRKSKKD
GNYKSRRHDNSSDEEGIEENGNKKDNGRSKPRFENRRRASKNAFRGM
Download sequence
Identical sequences YGR145W YGR145w___KOG2321 4932.YGR145W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]