SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR146C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGR146C-A   Protein: S000028638
Sequence length 53
Comment YGR146C-A SGDID:S000028638, Chr VII from 785442-785281, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MGFLPECNLTCAFLLHSFTFPIAHCPSFSWASFFFTIRPPFFPKLALVCTIFS
Download sequence
Identical sequences B3LI83 Q8TGT9
YGR146C-A 4932.YGR146C-A YGR146C-A YGR146C-A YGR146C-A SCRT_00873 YGR146C-A YGR146C-A YGR146C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]