SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YGR146C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR146C-A   Protein: S000028638
Sequence length 53
Comment YGR146C-A SGDID:S000028638, Chr VII from 785442-785281, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MGFLPECNLTCAFLLHSFTFPIAHCPSFSWASFFFTIRPPFFPKLALVCTIFS
Download sequence
Identical sequences B3LI83 Q8TGT9
YGR146C-A YGR146C-A YGR146C-A YGR146C-A SCRT_00873 YGR146C-A YGR146C-A YGR146C-A 4932.YGR146C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]