SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YGR151C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR151C   Protein: S000003383
Sequence length 111
Comment YGR151C SGDID:S000003383, Chr VII from 794995-794660, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps almost completely with the verified ORF RSR1/BUD1/YGR152C"
Sequence
MKWKVLQLKTQEIKVNNLAKSSLHQPGSLVLRNRIRNNQTISNHQKVYITNLHKDKLKLN
NLLRLMKSTNRHMPFRNLVLATGQELALLHNKRKRRKTLPLALFYSHLILL
Download sequence
Identical sequences P53287
4932.YGR151C YGR151C YGR151C YGR151C YGR151C YGR151C APC6382 YT469 YGR151C YGR151C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]