SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR151C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGR151C   Protein: S000003383
Sequence length 111
Comment YGR151C SGDID:S000003383, Chr VII from 794995-794660, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps almost completely with the verified ORF RSR1/BUD1/YGR152C"
Sequence
MKWKVLQLKTQEIKVNNLAKSSLHQPGSLVLRNRIRNNQTISNHQKVYITNLHKDKLKLN
NLLRLMKSTNRHMPFRNLVLATGQELALLHNKRKRRKTLPLALFYSHLILL
Download sequence
Identical sequences P53287
YGR151C 4932.YGR151C YGR151C YGR151C YGR151C YGR151C YGR151C APC6382 YT469 YGR151C

Jump to [ Top of page · Domain architecture · Domain assignment details ]