SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR158C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR158C
Domain Number 1 Region: 45-185
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.63e-11
Family Ribonuclease PH domain 1-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 66.81
nuclear chromosome 1.72 22.01
chromosomal part 1.477 22.01
condensed chromosome 2.188 22.01
ribosomal subunit 2.011 10.3
ribonucleoprotein complex 1.418 9.37
small nuclear ribonucleoprotein complex 2.005 6.93
microbody 1.956 6.65
organellar ribosome 2.15 6.46
chromatin 1.902 6.07

Protein sequence

External link(s) Locus: YGR158C   Protein: S000003390
Sequence length 250
Comment MTR3 SGDID:S000003390, Chr VII from 806026-805274, reverse complement, Verified ORF, "3'5' exoribonuclease, exosome subunit; nucleolar protein involved in export of mRNA and ribosomal subunits; homologous to the E. coli exonuclease RNase PH"
Sequence
MNVQDRRRLLGPAAAKPMAFSNTTTHVPEKKSTDLTPKGNESEQELSLHTGFIENCNGSA
LVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGI
FNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMMSSQISSLIPHCITSITLAL
ADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDL
MISCLMNQET
Download sequence
Identical sequences N1P453 P48240
YGR158C YGR158C 4932.YGR158C YGR158C YGR158C 4oo1.F YGR158C YGR158C YGR158c YT251 YGR158C YGR158C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]