SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGR158C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR158C
Domain Number 1 Region: 45-185
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000363
Family Ribonuclease PH domain 1-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR158C   Protein: S000003390
Sequence length 250
Comment MTR3 SGDID:S000003390, Chr VII from 806026-805274, reverse complement, Verified ORF, "3'5' exoribonuclease, exosome subunit; nucleolar protein involved in export of mRNA and ribosomal subunits; homologous to the E. coli exonuclease RNase PH"
Sequence
MNVQDRRRLLGPAAAKPMAFSNTTTHVPEKKSTDLTPKGNESEQELSLHTGFIENCNGSA
LVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGI
FNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMMSSQISSLIPHCITSITLAL
ADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDL
MISCLMNQET
Download sequence
Identical sequences A0A250WCI5 N1P453 P48240
YGR158C YGR158C YGR158C YGR158C YGR158C YGR158C YGR158c YT251 YGR158C cath|current|4oo1F00/5-248 4oo1.F 5k36.F YGR158C NP_011674.3.97178 4932.YGR158C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]