SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR158C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR158C
Domain Number 1 Region: 45-185
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.63e-11
Family Ribonuclease PH domain 1-like 0.0032
Further Details:      
 

Protein sequence

External link(s) Locus: YGR158C   Protein: S000003390
Sequence length 250
Comment MTR3 SGDID:S000003390, Chr VII from 806026-805274, reverse complement, Verified ORF, "3'5' exoribonuclease, exosome subunit; nucleolar protein involved in export of mRNA and ribosomal subunits; homologous to the E. coli exonuclease RNase PH"
Sequence
MNVQDRRRLLGPAAAKPMAFSNTTTHVPEKKSTDLTPKGNESEQELSLHTGFIENCNGSA
LVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGI
FNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMMSSQISSLIPHCITSITLAL
ADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDL
MISCLMNQET
Download sequence
Identical sequences P48240
YGR158C YGR158C 4932.YGR158C YGR158C YGR158C YGR158C YGR158C YGR158c YT251 YGR158C YGR158C

Jump to [ Top of page · Domain architecture · Domain assignment details ]