SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR161C-C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YGR161C-C
Domain Number - Region: 68-176
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0175
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 
Domain Number - Region: 222-302
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0654
Family HBL-like 0.054
Further Details:      
 

Protein sequence

External link(s) Locus: YGR161C-C   Protein: S000007367
Sequence length 440
Comment YGR161C-C SGDID:S000007367, Chr VII from 823020-821698, reverse complement, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLSNYPHISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPAS
SAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM
YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDI
LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNN
GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY
RRNPSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS
TTEPIQLNNKHDLHLRPETY
Download sequence
Identical sequences A6ZLP7 E7NP66 P0CX65 P0CX66 P0CX67 P0CX68 P0CX69
YBR012W-A YDR098C-A YDR261C-C YDR316W-A YER159C-A YGR027W-A YGR161C-C YJR026W YLR157C-A YLR227W-A YML045W-A YMR051C YOL103W-A YPR158C-C YDR316W-A YER159C-A YGR161C-C YMR051C 4932.YDR316W-A 4932.YER159C-A 4932.YGR161C-C 4932.YMR051C YDR316W-A YER159C-A YGR161C-C YMR051C YER159C-A YGR027W-A YJR028W YOR142W-A YPR137C-A YBR012W-A YER159C-A tr|A6ZLP7|A6ZLP7_YEAS7 YDR316W-A YER159C-A YGR161C-C YMR051C

Jump to [ Top of page · Domain architecture · Domain assignment details ]