SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR161W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YGR161W-A
Domain Number - Region: 74-169
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0288
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 

Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR161W-A   Protein: S000007369
Sequence length 438
Comment YGR161W-A SGDID:S000007369, Chr VII from 811743-813059, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLHQNPHSLHGSAYASVTSKEVPSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGT
SAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKAMASNWAHYQQPSMMTCSHYQTSPA
YYQPDPHYPLPQYIPPLSTSSPDPIDSQNQHSEVPQAETKVRNNVLPPHTLTSEENFSTW
VKFYIRFLKNSNLGDIIPNDQGEIKSQMTYEEHAYIYNTFQAFAPFHLLPTWVKQILEIN
YADILTVLCKSVSKMQTNNQELKDWIALANLEYDGSTSADTFEITVSTIIQRLKENNINV
SDRLACQLILKGLSGDFKYLRNQYRTKTNMKLSQLFAEIQLIYDENKIMNLNKPSQYKQH
SEYKNVSRTSPNTTNTKVTTRNYHRTNSSKPRAAKAHNIATSSKFSRVNNDHINESTVSS
QYLSDDNELSLRPATERI
Download sequence
Identical sequences P0CX61 P0CX62
YFL002W-B YGR161W-A 4932.YFL002W-B 4932.YGR161W-A YFL002W-B YGR161W-A YFL002W-B YGR161W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]