SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR161W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YGR161W-A
Domain Number - Region: 74-169
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0288
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR161W-A   Protein: S000007369
Sequence length 438
Comment YGR161W-A SGDID:S000007369, Chr VII from 811743-813059, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLHQNPHSLHGSAYASVTSKEVPSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGT
SAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKAMASNWAHYQQPSMMTCSHYQTSPA
YYQPDPHYPLPQYIPPLSTSSPDPIDSQNQHSEVPQAETKVRNNVLPPHTLTSEENFSTW
VKFYIRFLKNSNLGDIIPNDQGEIKSQMTYEEHAYIYNTFQAFAPFHLLPTWVKQILEIN
YADILTVLCKSVSKMQTNNQELKDWIALANLEYDGSTSADTFEITVSTIIQRLKENNINV
SDRLACQLILKGLSGDFKYLRNQYRTKTNMKLSQLFAEIQLIYDENKIMNLNKPSQYKQH
SEYKNVSRTSPNTTNTKVTTRNYHRTNSSKPRAAKAHNIATSSKFSRVNNDHINESTVSS
QYLSDDNELSLRPATERI
Download sequence
Identical sequences P0CX61 P0CX62
YFL002W-B YGR161W-A 4932.YFL002W-B 4932.YGR161W-A YFL002W-B YGR161W-A YFL002W-B YGR161W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]