SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGR180C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR180C
Domain Number 1 Region: 7-325
Classification Level Classification E-value
Superfamily Ferritin-like 5.58e-86
Family Ribonucleotide reductase-like 0.0000000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
iron ion homeostasis 2.005 50.79
cofactor metabolic process 1.43 22.64
coenzyme biosynthetic process 1.925 22.64
transition metal ion transport 2.096 20.34
regulation of body fluid levels 1.526 19.9
defense response 1.383 19.9
humoral immune response 1.94 19.9
ion homeostasis 1.497 19.2
maintenance of location 1.483 16.17
response to toxic substance 2.126 9.39
Cellular Component IC (bits) H-Score
fusome 2.127 13.18
oxidoreductase complex 1.774 12.02
cytosolic part 1.678 5.13
plastid 1.557 4.84

Protein sequence

External link(s) Locus: YGR180C   Protein: S000003412
Sequence length 345
Comment RNR4 SGDID:S000003412, Chr VII from 856306-855269, reverse complement, Verified ORF, "Ribonucleotide-diphosphate reductase (RNR), small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits"
Sequence
MEAHNQFLKTFQKERHDMKEAEKDEILLMENSRRFVMFPIKYHEIWAAYKKVEASFWTAE
EIELAKDTEDFQKLTDDQKTYIGNLLALSISSDNLVNKYLIENFSAQLQNPEGKSFYGFQ
IMMENIYSEVYSMMVDAFFKDPKNIPLFKEIANLPEVKHKAAFIERWISNDDSLYAERLV
AFAAKEGIFQAGNYASMFWLTDKKIMPGLAMANRNICRDRGAYTDFSCLLFAHLRTKPNP
KIIEKIITEAVEIEKEYYSNSLPVEKFGMDLKSIHTYIEFVADGLLQGFGNEKYYNAVNP
FEFMEDVATAGKTTFFEKKVSDYQKASDMSKSATPSKEINFDDDF
Download sequence
Identical sequences E7NI33 E7Q496 G2WER0 N1P3W2 P49723
YGR180C YGR180C YGR180C 1jk0B YGR180C YGR180C YGR180C YGR180C YGR180C YGR180C 1jk0.B 1sms.A 1sms.B YGR180C 4932.YGR180C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]