SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR180C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR180C
Domain Number 1 Region: 7-325
Classification Level Classification E-value
Superfamily Ferritin-like 5.58e-86
Family Ribonucleotide reductase-like 1.04e-11
Further Details:      
 

Protein sequence

External link(s) Locus: YGR180C   Protein: S000003412
Sequence length 345
Comment RNR4 SGDID:S000003412, Chr VII from 856306-855269, reverse complement, Verified ORF, "Ribonucleotide-diphosphate reductase (RNR), small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits"
Sequence
MEAHNQFLKTFQKERHDMKEAEKDEILLMENSRRFVMFPIKYHEIWAAYKKVEASFWTAE
EIELAKDTEDFQKLTDDQKTYIGNLLALSISSDNLVNKYLIENFSAQLQNPEGKSFYGFQ
IMMENIYSEVYSMMVDAFFKDPKNIPLFKEIANLPEVKHKAAFIERWISNDDSLYAERLV
AFAAKEGIFQAGNYASMFWLTDKKIMPGLAMANRNICRDRGAYTDFSCLLFAHLRTKPNP
KIIEKIITEAVEIEKEYYSNSLPVEKFGMDLKSIHTYIEFVADGLLQGFGNEKYYNAVNP
FEFMEDVATAGKTTFFEKKVSDYQKASDMSKSATPSKEINFDDDF
Download sequence
Identical sequences E7NI33 E7Q496 G2WER0 N1P3W2 P49723
YGR180C 1jk0B 4932.YGR180C YGR180C YGR180C YGR180C YGR180C 1jk0.B 1sms.A 1sms.B YGR180C YGR180C YGR180C YGR180C YGR180C

Jump to [ Top of page · Domain architecture · Domain assignment details ]