SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YGR181W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR181W
Domain Number 1 Region: 44-99
Classification Level Classification E-value
Superfamily Tim10-like 0.0000000000000249
Family Tim10/DDP 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
mitochondrial intermembrane space 2.197 101.08
mitochondrial envelope 1.57 39.91
mitochondrial inner membrane 1.751 11.78
organelle inner membrane 1.672 6.84
Molecular Function IC (bits) H-Score
protein transporter activity 2.239 64.45
P-P-bond-hydrolysis-driven transmembrane transporter activity 1.99 5.96

Protein sequence

External link(s) Locus: YGR181W   Protein: S000003413
Sequence length 105
Comment TIM13 SGDID:S000003413, Chr VII from 858292-858609, Verified ORF, "Mitochondrial intermembrane space protein, forms a complex with TIm8p that mediates import and insertion of a subset of polytopic inner membrane proteins; may prevent aggregation of incoming proteins in a chaperone-like manner"
Sequence
MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELVNKISENCFEK
CLTSPYATRNDACIDQCLAKYMRSWNVISKAYISRIQNASASGEI
Download sequence
Identical sequences A6ZUJ3 B3LI50 C7GVV8 E7KCY3 E7NI34 G2WER1 N1P2G4 P53299 W7PH07 W7QYH1
YGR181W YGR181W YGR181w___KOG1733 YGR181W YGR181W 354986 YGR181W YGR181W YGR181W YGR181W 4932.YGR181W YGR181W YGR181W YGR181W SCRT_00839 YGR181W YGR181W YGR181W YGR181W YGR181W YGR181W YGR181W YGR181W tr|A6ZUJ3|A6ZUJ3_YEAS7 YGR181W YGR181W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]