SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR188C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR188C
Domain Number 1 Region: 704-968
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-32
Family Protein kinases, catalytic subunit 0.0065
Further Details:      
 

Protein sequence

External link(s) Locus: YGR188C   Protein: S000003420
Sequence length 1021
Comment BUB1 SGDID:S000003420, Chr VII from 875114-872049, reverse complement, Verified ORF, "Protein kinase that forms a complex with Mad1p and Bub3p that is crucial in the checkpoint mechanism required to prevent cell cycle progression into anaphase in the presence of spindle damage, associates with centromere DNA via Skp1p"
Sequence
MNLDLGSTVRGYESDKDTFPQSKGVSSSQKEQHSQLNQTKIAYEQRLLNDLEDMDDPLDL
FLDYMIWISTSYIEVDSESGQEVLRSTMERCLIYIQDMETYRNDPRFLKIWIWYINLFLS
NNFHESENTFKYMFNKGIGTKLSLFYEEFSKLLENAQFFLEAKVLLELGAENNCRPYNRL
LRSLSNYEDRLREMNIVENQNSVPDSRERLKGRLIYRTAPFFIRKFLTSSLMTDDKENRA
NLNSNVGVGKSAPNVYQDSIVVADFKSETERLNLNSSKQPSNQRLKNGNKKTSIYADQKQ
SNNPVYKLINTPGRKPERIVFNFNLIYPENDEEFNTEEILAMIKGLYKVQRRGKKHTEDY
TSDKNRKKRKLDVLVERRQDLPSSQPPVVPKSTRIEVFKDDDNPSQSTHHKNTQVQVQTT
TSILPLKPVVDGNLAHETPVKPSLTSNASRSPTVTAFSKDAINEVFSMFNQHYSTPGALL
DGDDTTTSKFNVFENFTQEFTAKNIEDLTEVKDPKQETVSQQTTSTNETNDRYERLSNSS
TRPEKADYMTPIKETTETDVVPIIQTPKEQIRTEDKKSGDNTETQTQLTSTTIQSSPFLT
QPEPQAEKLLQTAEHSEKSKEHYPTIIPPFTKIKNQPPVIIENPLSNNLRAKFLSEISPP
LFQYNTFYNYNQELKMSSLLKKIHRVSRNENKNPIVDFKKTGDLYCIRGELGEGGYATVY
LAESSQGHLRALKVEKPASVWEYYIMSQVEFRLRKSTILKSIINASALHLFLDESYLVLN
YASQGTVLDLINLQREKAIDGNGIMDEYLCMFITVELMKVLEKIHEVGIIHGDLKPDNCM
IRLEKPGEPLGAHYMRNGEDGWENKGIYLIDFGRSFDMTLLPPGTKFKSNWKADQQDCWE
MRAGKPWSYEADYYGLAGVIHSMLFGKFIETIQLQNGRCKLKNPFKRYWKKEIWGVIFDL
LLNSGQASNQALPMTEKIVEIRNLIESHLEQHAENHLRNVILSIEEELSHFQYKGKPSRR
F
Download sequence
Identical sequences P41695
YGR188C YGR188C 4932.YGR188C YGR188C YR245 YGR188C

Jump to [ Top of page · Domain architecture · Domain assignment details ]