SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGR188C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR188C
Domain Number 1 Region: 704-968
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-32
Family Protein kinases, catalytic subunit 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
plasma membrane receptor complex 1.824 13.31
spindle 1.815 12.85
cytosol 1.295 12.48
chromosomal part 1.512 9.33
synapse part 1.419 8.28
midbody 2.182 8.19
cell division site 2.125 8.13
nuclear chromosome part 1.842 8.05
site of polarized growth 1.648 7.71
cytoplasmic region 1.567 7.39
Molecular Function IC (bits) H-Score
transmembrane receptor protein kinase activity 1.662 87.19
growth factor binding 1.592 45.46
ATP binding 1.433 38.77
lyase activity 1.408 25.05
cytokine binding 1.952 24.28
calmodulin binding 2.02 18.7
magnesium ion binding 1.87 15.88
double-stranded DNA binding 1.546 15.2
protein domain specific binding 1.452 12.79
enzyme activator activity 1.431 10.25

Protein sequence

External link(s) Locus: YGR188C   Protein: S000003420
Sequence length 1021
Comment BUB1 SGDID:S000003420, Chr VII from 875114-872049, reverse complement, Verified ORF, "Protein kinase that forms a complex with Mad1p and Bub3p that is crucial in the checkpoint mechanism required to prevent cell cycle progression into anaphase in the presence of spindle damage, associates with centromere DNA via Skp1p"
Sequence
MNLDLGSTVRGYESDKDTFPQSKGVSSSQKEQHSQLNQTKIAYEQRLLNDLEDMDDPLDL
FLDYMIWISTSYIEVDSESGQEVLRSTMERCLIYIQDMETYRNDPRFLKIWIWYINLFLS
NNFHESENTFKYMFNKGIGTKLSLFYEEFSKLLENAQFFLEAKVLLELGAENNCRPYNRL
LRSLSNYEDRLREMNIVENQNSVPDSRERLKGRLIYRTAPFFIRKFLTSSLMTDDKENRA
NLNSNVGVGKSAPNVYQDSIVVADFKSETERLNLNSSKQPSNQRLKNGNKKTSIYADQKQ
SNNPVYKLINTPGRKPERIVFNFNLIYPENDEEFNTEEILAMIKGLYKVQRRGKKHTEDY
TSDKNRKKRKLDVLVERRQDLPSSQPPVVPKSTRIEVFKDDDNPSQSTHHKNTQVQVQTT
TSILPLKPVVDGNLAHETPVKPSLTSNASRSPTVTAFSKDAINEVFSMFNQHYSTPGALL
DGDDTTTSKFNVFENFTQEFTAKNIEDLTEVKDPKQETVSQQTTSTNETNDRYERLSNSS
TRPEKADYMTPIKETTETDVVPIIQTPKEQIRTEDKKSGDNTETQTQLTSTTIQSSPFLT
QPEPQAEKLLQTAEHSEKSKEHYPTIIPPFTKIKNQPPVIIENPLSNNLRAKFLSEISPP
LFQYNTFYNYNQELKMSSLLKKIHRVSRNENKNPIVDFKKTGDLYCIRGELGEGGYATVY
LAESSQGHLRALKVEKPASVWEYYIMSQVEFRLRKSTILKSIINASALHLFLDESYLVLN
YASQGTVLDLINLQREKAIDGNGIMDEYLCMFITVELMKVLEKIHEVGIIHGDLKPDNCM
IRLEKPGEPLGAHYMRNGEDGWENKGIYLIDFGRSFDMTLLPPGTKFKSNWKADQQDCWE
MRAGKPWSYEADYYGLAGVIHSMLFGKFIETIQLQNGRCKLKNPFKRYWKKEIWGVIFDL
LLNSGQASNQALPMTEKIVEIRNLIESHLEQHAENHLRNVILSIEEELSHFQYKGKPSRR
F
Download sequence
Identical sequences N1P2H0 P41695
YGR188C YR245 4932.YGR188C YGR188C YGR188C YGR188C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]