SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR200C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR200C
Domain Number 1 Region: 47-129,188-243,277-461
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.88e-37
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 2 Region: 548-785
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.02e-30
Family WD40-repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
amide binding 1.714 18.59
peptide binding 1.778 18.59
kinase binding 1.685 13.41
protein serine/threonine kinase activity 1.729 10.46
transferase activity, transferring one-carbon groups 1.589 10.31
S-adenosylmethionine-dependent methyltransferase activity 2.083 10.31
RNA binding 1.36 9.89
histone binding 1.837 8.74
transcription regulatory region DNA binding 1.451 8.43
enzyme activator activity 1.402 8.11
Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.939 42.7
nucleolus 1.644 36.88
methyltransferase complex 2.219 18.65
cilium 1.617 16.76
vacuole 1.428 11.95
nucleoplasm part 1.418 11.46
transcription factor complex 1.882 11.46
cytoplasmic vesicle part 1.738 10.37
cytoplasmic vesicle membrane 1.923 10.37
SWI/SNF superfamily-type complex 2.178 9.97
Biological Process IC (bits) H-Score
epithelial tube morphogenesis 1.317 24.18
urogenital system development 1.519 24.18
regulation of organ morphogenesis 1.647 23.79
regulation of epithelial cell differentiation 1.826 23.79
digestive tract development 1.946 21.87
cilium morphogenesis 1.417 21.46
cilium organization 2.119 21.36
rRNA metabolic process 2.197 19.5
RNA processing 1.458 15.59
negative regulation of multicellular organismal process 1.494 15.39

Protein sequence

External link(s) Locus: YGR200C   Protein: S000003432
Sequence length 788
Comment ELP2 SGDID:S000003432, Chr VII from 902275-899909, reverse complement, Verified ORF, "Subunit of Elongator complex, which is required for modification of wobble nucleosides in tRNA; target of Kluyveromyces lactis zymocin"
Sequence
MVECITPEAIFIGANKQTQVSDIHKVKKIVAFGAGKTIALWDPIEPNNKGVYATLKGHEA
EVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQCIQTIQHYSKTIVALSALPSLISVG
CADGTISIWRQNIQNDEFGLAHEFTIKKGFFYPLCLSLSKVEEKKYLLAIGGTNVNVFIA
SFILSDSGIEKCRVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDL
IDDSEEDSKKLTLLSNKQYKFQIDDELRVGINFEALIMGHDDWISSLQWHESRLQLLAAT
ADTSLMVWEPDETSGIWVCSLRLGEMSSKGASTATGSSGGFWSCLWFTHERMDFFLTNGK
TGSWRMWATKDNIICDQRLGISGATKDVTDIAWSPSGEYLLATSLDQTTRLFAPWIYDAS
GRKREIATWHEFSRPQIHGYDMICVETVTDTRFVSGGDEKILRSFDLPKGVAGMLQKFVG
IQFEEKSEMPDSATVPVLGLSNKAGEDDANEDDEEEEGGNKETPDITDPLSLLECPPMED
QLQRHLLWPEVEKLYGHGFEITCLDISPDQKLIASACRSNNVQNAVIRIFSTENWLEIKP
ALPFHSLTITRLKFSKDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDAD
WAPLEFGNVFVTASRDKTVKVWRHQKEPADDYVLEASIKHTKAVTAISIHDSMIREKILI
SVGLENGEIYLYSYTLGKFELITQLNEDITPADKITRLRWSHLKRNGKLFLGVGSSDLST
RIYSLAYE
Download sequence
Identical sequences N1P629 P42935
YGR200C YGR200C 4932.YGR200C YGR200C YGR200C YGR200C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]