SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR200C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR200C
Domain Number 1 Region: 47-129,188-243,277-461
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.88e-37
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 2 Region: 548-785
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.02e-30
Family WD40-repeat 0.0016
Further Details:      
 

Protein sequence

External link(s) Locus: YGR200C   Protein: S000003432
Sequence length 788
Comment ELP2 SGDID:S000003432, Chr VII from 902275-899909, reverse complement, Verified ORF, "Subunit of Elongator complex, which is required for modification of wobble nucleosides in tRNA; target of Kluyveromyces lactis zymocin"
Sequence
MVECITPEAIFIGANKQTQVSDIHKVKKIVAFGAGKTIALWDPIEPNNKGVYATLKGHEA
EVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQCIQTIQHYSKTIVALSALPSLISVG
CADGTISIWRQNIQNDEFGLAHEFTIKKGFFYPLCLSLSKVEEKKYLLAIGGTNVNVFIA
SFILSDSGIEKCRVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDL
IDDSEEDSKKLTLLSNKQYKFQIDDELRVGINFEALIMGHDDWISSLQWHESRLQLLAAT
ADTSLMVWEPDETSGIWVCSLRLGEMSSKGASTATGSSGGFWSCLWFTHERMDFFLTNGK
TGSWRMWATKDNIICDQRLGISGATKDVTDIAWSPSGEYLLATSLDQTTRLFAPWIYDAS
GRKREIATWHEFSRPQIHGYDMICVETVTDTRFVSGGDEKILRSFDLPKGVAGMLQKFVG
IQFEEKSEMPDSATVPVLGLSNKAGEDDANEDDEEEEGGNKETPDITDPLSLLECPPMED
QLQRHLLWPEVEKLYGHGFEITCLDISPDQKLIASACRSNNVQNAVIRIFSTENWLEIKP
ALPFHSLTITRLKFSKDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDAD
WAPLEFGNVFVTASRDKTVKVWRHQKEPADDYVLEASIKHTKAVTAISIHDSMIREKILI
SVGLENGEIYLYSYTLGKFELITQLNEDITPADKITRLRWSHLKRNGKLFLGVGSSDLST
RIYSLAYE
Download sequence
Identical sequences P42935
YGR200C YGR200C 4932.YGR200C YGR200C YGR200C YGR200C

Jump to [ Top of page · Domain architecture · Domain assignment details ]