SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR200C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR200C
Domain Number 1 Region: 47-129,188-243,277-461
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.88e-37
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 2 Region: 548-785
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.02e-30
Family WD40-repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 41.05
nucleolus 1.641 36.88
methyltransferase complex 2.218 18.65
cilium 1.573 18.45
transcription factor complex 1.912 12.5
chromosomal part 1.477 12.4
cytoplasmic vesicle part 1.73 10.22
cytoplasmic vesicle membrane 1.912 10.22
SWI/SNF superfamily-type complex 2.178 9.97
ciliary part 1.844 9.85

Protein sequence

External link(s) Locus: YGR200C   Protein: S000003432
Sequence length 788
Comment ELP2 SGDID:S000003432, Chr VII from 902275-899909, reverse complement, Verified ORF, "Subunit of Elongator complex, which is required for modification of wobble nucleosides in tRNA; target of Kluyveromyces lactis zymocin"
Sequence
MVECITPEAIFIGANKQTQVSDIHKVKKIVAFGAGKTIALWDPIEPNNKGVYATLKGHEA
EVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQCIQTIQHYSKTIVALSALPSLISVG
CADGTISIWRQNIQNDEFGLAHEFTIKKGFFYPLCLSLSKVEEKKYLLAIGGTNVNVFIA
SFILSDSGIEKCRVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDL
IDDSEEDSKKLTLLSNKQYKFQIDDELRVGINFEALIMGHDDWISSLQWHESRLQLLAAT
ADTSLMVWEPDETSGIWVCSLRLGEMSSKGASTATGSSGGFWSCLWFTHERMDFFLTNGK
TGSWRMWATKDNIICDQRLGISGATKDVTDIAWSPSGEYLLATSLDQTTRLFAPWIYDAS
GRKREIATWHEFSRPQIHGYDMICVETVTDTRFVSGGDEKILRSFDLPKGVAGMLQKFVG
IQFEEKSEMPDSATVPVLGLSNKAGEDDANEDDEEEEGGNKETPDITDPLSLLECPPMED
QLQRHLLWPEVEKLYGHGFEITCLDISPDQKLIASACRSNNVQNAVIRIFSTENWLEIKP
ALPFHSLTITRLKFSKDGKFLLSVCRDRKWALWERNMEDNTFELRFKNEKPHTRIIWDAD
WAPLEFGNVFVTASRDKTVKVWRHQKEPADDYVLEASIKHTKAVTAISIHDSMIREKILI
SVGLENGEIYLYSYTLGKFELITQLNEDITPADKITRLRWSHLKRNGKLFLGVGSSDLST
RIYSLAYE
Download sequence
Identical sequences N1P629 P42935
YGR200C YGR200C YGR200C 4932.YGR200C YGR200C YGR200C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]