SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGR225W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR225W
Domain Number 1 Region: 224-556
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-39
Family WD40-repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
RNA processing 1.499 17.76
telomere organization 2.237 16.58
microtubule-based movement 1.993 16.43
process utilizing autophagic mechanism 2.127 15.81
microtubule-based process 1.532 14.67
Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
cytoplasmic vesicle part 1.417 9.77
endosome 1.351 9.77
endosome membrane 1.934 9.77

Protein sequence

External link(s) Locus: YGR225W   Protein: S000003457
Sequence length 593
Comment AMA1 SGDID:S000003457, Chr VII from 945148-946330,946424-947022, Verified ORF, "Activator of meiotic anaphase promoting complex (APC/C); Cdc20p family member; required for initiation of spore wall assembly; required for Clb1p degradation during meiosis"
Sequence
MATPHLYHRYNSKSSNKNINSSGNSTEVDRFIPKSVSRNAYKSIPMLNGFDISYSELCEK
SPSPERLSSPEFFNELRNTGHYESISTTNEFSMSSISSSSESQVTRSGSARASRNDYSKL
TKEQKDHRKNIAHSLGFQLPDRVFTFETTSAEILEKNKAIKNCFGPGSCAEIRSTFDFST
LSPDVARYYIANSNARSASPQRQIQRPAKRVKSHIPYRVLDAPCLRNDFYSNLISWSRTT
NNVLVGLGCSVYIWSEKEGAVSILDHQYLSEKRDLVTCVSFCPYNTYFIVGTKFGRILLY
DQKEFFHSSNTNEKEPVFVFQTESFKGICCLEWFKPGEICKFYVGEENGNVSLFEIKSLH
FPIKNWSKRQKLEDENLIGLKLHSTYQAQAQQVCGISLNEHANLLAVGGNDNSCSLWDIS
DLDKPIKKFVLPHKAAVKAIAFCPWSKSLLATGGGSKDRCIKFWHTSTGTLLDEICTSGQ
VTSLIWSLRHKQIVATFGFGDTKNPVLITLYSYPKLSKLLEVRSPNPLRVLSAVISPSSM
AICVATNDETIRFYELWNDKEEIINEIQESGIYGSNIIEYMEGIETTHNKRIR
Download sequence
Identical sequences N1P2K4 P50082
4932.YGR225W YGR225W YGR225W YGR225W YGR225W YGR225W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]