SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR225W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR225W
Domain Number 1 Region: 224-556
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-39
Family WD40-repeat 0.0062
Further Details:      
 

Protein sequence

External link(s) Locus: YGR225W   Protein: S000003457
Sequence length 593
Comment AMA1 SGDID:S000003457, Chr VII from 945148-946330,946424-947022, Verified ORF, "Activator of meiotic anaphase promoting complex (APC/C); Cdc20p family member; required for initiation of spore wall assembly; required for Clb1p degradation during meiosis"
Sequence
MATPHLYHRYNSKSSNKNINSSGNSTEVDRFIPKSVSRNAYKSIPMLNGFDISYSELCEK
SPSPERLSSPEFFNELRNTGHYESISTTNEFSMSSISSSSESQVTRSGSARASRNDYSKL
TKEQKDHRKNIAHSLGFQLPDRVFTFETTSAEILEKNKAIKNCFGPGSCAEIRSTFDFST
LSPDVARYYIANSNARSASPQRQIQRPAKRVKSHIPYRVLDAPCLRNDFYSNLISWSRTT
NNVLVGLGCSVYIWSEKEGAVSILDHQYLSEKRDLVTCVSFCPYNTYFIVGTKFGRILLY
DQKEFFHSSNTNEKEPVFVFQTESFKGICCLEWFKPGEICKFYVGEENGNVSLFEIKSLH
FPIKNWSKRQKLEDENLIGLKLHSTYQAQAQQVCGISLNEHANLLAVGGNDNSCSLWDIS
DLDKPIKKFVLPHKAAVKAIAFCPWSKSLLATGGGSKDRCIKFWHTSTGTLLDEICTSGQ
VTSLIWSLRHKQIVATFGFGDTKNPVLITLYSYPKLSKLLEVRSPNPLRVLSAVISPSSM
AICVATNDETIRFYELWNDKEEIINEIQESGIYGSNIIEYMEGIETTHNKRIR
Download sequence
Identical sequences P50082
YGR225W YGR225W 4932.YGR225W YGR225W YGR225W YGR225W

Jump to [ Top of page · Domain architecture · Domain assignment details ]