SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR225W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR225W
Domain Number 1 Region: 224-556
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-39
Family WD40-repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 41.05
nucleolus 1.641 36.88
methyltransferase complex 2.218 18.65
cilium 1.573 18.45
transcription factor complex 1.912 12.5
chromosomal part 1.477 12.4
cytoplasmic vesicle part 1.73 10.22
cytoplasmic vesicle membrane 1.912 10.22
SWI/SNF superfamily-type complex 2.178 9.97
ciliary part 1.844 9.85

Protein sequence

External link(s) Locus: YGR225W   Protein: S000003457
Sequence length 593
Comment AMA1 SGDID:S000003457, Chr VII from 945148-946330,946424-947022, Verified ORF, "Activator of meiotic anaphase promoting complex (APC/C); Cdc20p family member; required for initiation of spore wall assembly; required for Clb1p degradation during meiosis"
Sequence
MATPHLYHRYNSKSSNKNINSSGNSTEVDRFIPKSVSRNAYKSIPMLNGFDISYSELCEK
SPSPERLSSPEFFNELRNTGHYESISTTNEFSMSSISSSSESQVTRSGSARASRNDYSKL
TKEQKDHRKNIAHSLGFQLPDRVFTFETTSAEILEKNKAIKNCFGPGSCAEIRSTFDFST
LSPDVARYYIANSNARSASPQRQIQRPAKRVKSHIPYRVLDAPCLRNDFYSNLISWSRTT
NNVLVGLGCSVYIWSEKEGAVSILDHQYLSEKRDLVTCVSFCPYNTYFIVGTKFGRILLY
DQKEFFHSSNTNEKEPVFVFQTESFKGICCLEWFKPGEICKFYVGEENGNVSLFEIKSLH
FPIKNWSKRQKLEDENLIGLKLHSTYQAQAQQVCGISLNEHANLLAVGGNDNSCSLWDIS
DLDKPIKKFVLPHKAAVKAIAFCPWSKSLLATGGGSKDRCIKFWHTSTGTLLDEICTSGQ
VTSLIWSLRHKQIVATFGFGDTKNPVLITLYSYPKLSKLLEVRSPNPLRVLSAVISPSSM
AICVATNDETIRFYELWNDKEEIINEIQESGIYGSNIIEYMEGIETTHNKRIR
Download sequence
Identical sequences N1P2K4 P50082
YGR225W YGR225W YGR225W YGR225W YGR225W 4932.YGR225W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]