SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR226C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR226C   Protein: S000003458
Sequence length 69
Comment YGR226C SGDID:S000003458, Chr VII from 947004-946795, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; overlaps significantly with a verified ORF, AMA1/YGR225W"
Sequence
MCCFDTLHIFYNIRSINPTLLNFINYFLLIVPQFIKSYRFIVSGNANCHGTWRDYCAQYT
QRVGRPNFE
Download sequence
Identical sequences P50083
YGR226C YGR226C YGR226C YGR226C YGR226C YGR226C YGR226C 4932.YGR226C YGR226C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]