SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR226C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGR226C   Protein: S000003458
Sequence length 69
Comment YGR226C SGDID:S000003458, Chr VII from 947004-946795, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; overlaps significantly with a verified ORF, AMA1/YGR225W"
Sequence
MCCFDTLHIFYNIRSINPTLLNFINYFLLIVPQFIKSYRFIVSGNANCHGTWRDYCAQYT
QRVGRPNFE
Download sequence
Identical sequences P50083
YGR226C 4932.YGR226C YGR226C YGR226C YGR226C YGR226C YGR226C YGR226C YGR226C

Jump to [ Top of page · Domain architecture · Domain assignment details ]