SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR239C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YGR239C
Domain Number - Region: 108-142
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.0379
Family Chemosensory protein Csp2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR239C   Protein: S000003471
Sequence length 288
Comment PEX21 SGDID:S000003471, Chr VII from 970058-969192, reverse complement, Verified ORF, "Peroxin required for targeting of peroxisomal matrix proteins containing PTS2; interacts with Pex7p; partially redundant with Pex18p"
Sequence
MPSVCHTSPIEKIIQQGHRIQNDSLIPSKRTKLAHTELTAHYATEDSHVEKHFLHNGSNF
DGIDNVRYQNQPSPLTFITPNNTVDSSDWVPQFSSMKIDDSLEFSSEYKRLYSNYESQQR
LNSSRQHLPFKNCMIRKTSCTYPPQKTLRQQRQGNRDNPTDAFQFDAEFQVLEREIQKER
YEPITRRDEKWFDQDQSELQRIATDIVKCCTPPPSSASSSSTLSSSVESKLSESKFIQLM
RNISSGDVTLKKNADGNSASELFSSNNGELVGNRHIFVKDEIHKDILD
Download sequence
Identical sequences A6ZUP7 B5VJH9 C7GNJ0 C8Z9D0 E7KD30 E7KNV1 E7QFA9 H0GGX1 N1P422 P50091 W7PH40 W7RBJ5
YGR239C YGR239C 4932.YGR239C YGR239C YGR239C YGR239C YGR239C YGR239C YGR239C YGR239C tr|A6ZUP7|A6ZUP7_YEAS7 YGR239C YGR239C YGR239C YGR239C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]