SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR239C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YGR239C
Domain Number - Region: 108-142
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.0379
Family Chemosensory protein Csp2 0.011
Further Details:      
 

Protein sequence

External link(s) Locus: YGR239C   Protein: S000003471
Sequence length 288
Comment PEX21 SGDID:S000003471, Chr VII from 970058-969192, reverse complement, Verified ORF, "Peroxin required for targeting of peroxisomal matrix proteins containing PTS2; interacts with Pex7p; partially redundant with Pex18p"
Sequence
MPSVCHTSPIEKIIQQGHRIQNDSLIPSKRTKLAHTELTAHYATEDSHVEKHFLHNGSNF
DGIDNVRYQNQPSPLTFITPNNTVDSSDWVPQFSSMKIDDSLEFSSEYKRLYSNYESQQR
LNSSRQHLPFKNCMIRKTSCTYPPQKTLRQQRQGNRDNPTDAFQFDAEFQVLEREIQKER
YEPITRRDEKWFDQDQSELQRIATDIVKCCTPPPSSASSSSTLSSSVESKLSESKFIQLM
RNISSGDVTLKKNADGNSASELFSSNNGELVGNRHIFVKDEIHKDILD
Download sequence
Identical sequences A6ZUP7 B5VJH9 C7GNJ0 C8Z9D0 E7KD30 E7KNV1 E7QFA9 H0GGX1 P50091
YGR239C YGR239C YGR239C YGR239C YGR239C YGR239C YGR239C YGR239C 4932.YGR239C YGR239C YGR239C tr|A6ZUP7|A6ZUP7_YEAS7 YGR239C YGR239C YGR239C

Jump to [ Top of page · Domain architecture · Domain assignment details ]