SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR246C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR246C
Domain Number 1 Region: 176-270
Classification Level Classification E-value
Superfamily Cyclin-like 1.1e-26
Family Transcription factor IIB (TFIIB), core domain 0.0046
Further Details:      
 
Domain Number 2 Region: 82-170
Classification Level Classification E-value
Superfamily Cyclin-like 5.81e-21
Family Transcription factor IIB (TFIIB), core domain 0.0081
Further Details:      
 
Domain Number 3 Region: 3-46
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000000196
Family Transcriptional factor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
RNA polymerase complex 1.998 36.94
transcription factor complex 1.912 15.69
transferase complex 1.423 14.95
chromosomal part 1.477 11.31
ubiquitin ligase complex 1.917 11.3
microtubule cytoskeleton 1.341 7.83
centrosome 1.793 7.72
spindle 1.789 4.57
nucleoplasm part 1.496 4.11

Protein sequence

External link(s) Locus: YGR246C   Protein: S000003478
Sequence length 596
Comment BRF1 SGDID:S000003478, Chr VII from 984277-982487, reverse complement, Verified ORF, "TFIIIB B-related factor, one of three subunits of RNA polymerase III transcription initiation factor TFIIIB, binds TFIIIC and TBP and recruits RNA pol III to promoters, amino-terminal half is homologous to TFIIB"
Sequence
MPVCKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSEVTFGETSAGAAVVQGSFIGA
GQSHAAFGGSSALESREATLNNARRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGR
RSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGATFLKMVKKLHITELPLADPSL
FIQHFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMNNLRRT
HTEIVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDGEARPPSFVKNRKKERKI
KDSLDKEEMFQTSEEALNKNPILTQVLGEQELSSKEVLFYLKQFSERRARVVERIKATNG
IDGENIYHEGSENETRKRKLSEVSIQNEHVEGEDKETEGTEEKVKKVKTKTSEEKKENES
GHFQDAIDGYSLETDPYCPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEAS
KLKERIWIGLNADFLLEQESKRLKQEADIATGNTSVKKKRTRRRNNTRSDEPTKTVDAAA
AIGLMSDLQDKSGLHAALKAAEESGDFTTADSVKNMLQKASFSKKINYDAIDGLFR
Download sequence
Identical sequences N1P9Z1 P29056
4932.YGR246C YGR246C YGR246C YGR246C YGR246C YGR246C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]