SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR246C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR246C
Domain Number 1 Region: 176-270
Classification Level Classification E-value
Superfamily Cyclin-like 1.1e-26
Family Transcription factor IIB (TFIIB), core domain 0.0046
Further Details:      
 
Domain Number 2 Region: 82-170
Classification Level Classification E-value
Superfamily Cyclin-like 5.81e-21
Family Transcription factor IIB (TFIIB), core domain 0.0081
Further Details:      
 
Domain Number 3 Region: 3-46
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.96e-07
Family Transcriptional factor domain 0.018
Further Details:      
 

Protein sequence

External link(s) Locus: YGR246C   Protein: S000003478
Sequence length 596
Comment BRF1 SGDID:S000003478, Chr VII from 984277-982487, reverse complement, Verified ORF, "TFIIIB B-related factor, one of three subunits of RNA polymerase III transcription initiation factor TFIIIB, binds TFIIIC and TBP and recruits RNA pol III to promoters, amino-terminal half is homologous to TFIIB"
Sequence
MPVCKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSEVTFGETSAGAAVVQGSFIGA
GQSHAAFGGSSALESREATLNNARRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGR
RSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGATFLKMVKKLHITELPLADPSL
FIQHFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMNNLRRT
HTEIVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDGEARPPSFVKNRKKERKI
KDSLDKEEMFQTSEEALNKNPILTQVLGEQELSSKEVLFYLKQFSERRARVVERIKATNG
IDGENIYHEGSENETRKRKLSEVSIQNEHVEGEDKETEGTEEKVKKVKTKTSEEKKENES
GHFQDAIDGYSLETDPYCPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEAS
KLKERIWIGLNADFLLEQESKRLKQEADIATGNTSVKKKRTRRRNNTRSDEPTKTVDAAA
AIGLMSDLQDKSGLHAALKAAEESGDFTTADSVKNMLQKASFSKKINYDAIDGLFR
Download sequence
Identical sequences N1P9Z1 P29056
YGR246C YGR246C 4932.YGR246C YGR246C YGR246C YGR246C

Jump to [ Top of page · Domain architecture · Domain assignment details ]