SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR248W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR248W
Domain Number 1 Region: 3-252
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.56e-45
Family NagB-like 0.00076
Further Details:      
 

Protein sequence

External link(s) Locus: YGR248W   Protein: S000003480
Sequence length 255
Comment SOL4 SGDID:S000003480, Chr VII from 985977-986744, Verified ORF, "6-phosphogluconolactonase with similarity to Sol3p"
Sequence
MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQALYESLVNDKNI
FPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLVHQGNQLNLGPTVYTINESLI
GGGETANRKIAEEYASMLPASFDLILLGCGEDGHTCSLFPGVEFNYLVEEMDRKVLWCNN
SPKAPKDRITFTLAVVAEAKSVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVT
WFLDDEAGALIPENC
Download sequence
Identical sequences N1P673 P53315
YGR248W YGR248W 4932.YGR248W YGR248W YGR248W YGR248W

Jump to [ Top of page · Domain architecture · Domain assignment details ]