SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR248W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR248W
Domain Number 1 Region: 3-252
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 6.56e-45
Family NagB-like 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribonucleoprotein complex 1.418 5.2
spliceosomal complex 2.025 5.2

Protein sequence

External link(s) Locus: YGR248W   Protein: S000003480
Sequence length 255
Comment SOL4 SGDID:S000003480, Chr VII from 985977-986744, Verified ORF, "6-phosphogluconolactonase with similarity to Sol3p"
Sequence
MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQALYESLVNDKNI
FPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLVHQGNQLNLGPTVYTINESLI
GGGETANRKIAEEYASMLPASFDLILLGCGEDGHTCSLFPGVEFNYLVEEMDRKVLWCNN
SPKAPKDRITFTLAVVAEAKSVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVT
WFLDDEAGALIPENC
Download sequence
Identical sequences N1P673 P53315
YGR248W YGR248W 4932.YGR248W YGR248W YGR248W YGR248W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]