SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR264C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR264C
Domain Number 1 Region: 196-332,367-577
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.48e-89
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 3.79e-07
Further Details:      
 
Domain Number 2 Region: 582-747
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 8.04e-31
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00054
Further Details:      
 
Domain Number 3 Region: 333-367
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 1.44e-12
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0012
Further Details:      
 

Protein sequence

External link(s) Locus: YGR264C   Protein: S000003496
Sequence length 751
Comment MES1 SGDID:S000003496, Chr VII from 1021859-1019604, reverse complement, Verified ORF, "Methionyl-tRNA synthetase, forms a complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p, which increases the catalytic efficiency of both tRNA synthetases; also has a role in nuclear export of tRNAs"
Sequence
MSFLISFDKSKKHPAHLQLANNLKIALALEYASKNLKPEVDNDNAAMELRNTKEPFLLFD
ANAILRYVMDDFEGQTSDKYQFALASLQNLLYHKELPQQHVEVLTNKAIENYLVELKEPL
TTTDLILFANVYALNSSLVHSKFPELPSKVHNAVALAKKHVPRDSSSFKNIGAVKIQADL
TVKPKDSEILPKPNERNILITSALPYVNNVPHLGNIIGSVLSADIFARYCKGRNYNALFI
CGTDEYGTATETKALEEGVTPRQLCDKYHKIHSDVYKWFQIGFDYFGRTTTDKQTEIAQH
IFTKLNSNGYLEEQSMKQLYCPVHNSYLADRYVEGECPKCHYDDARGDQCDKCGALLDPF
ELINPRCKLDDASPEPKYSDHIFLSLDKLESQISEWVEKASEEGNWSKNSKTITQSWLKD
GLKPRCITRDLVWGTPVPLEKYKDKVLYVWFDATIGYVSITSNYTKEWKQWWNNPEHVSL
YQFMGKDNVPFHTVVFPGSQLGTEENWTMLHHLNTTEYLQYENGKFSKSRGVGVFGNNAQ
DSGISPSVWRYYLASVRPESSDSHFSWDDFVARNNSELLANLGNFVNRLIKFVNAKYNGV
VPKFDPKKVSNYDGLVKDINEILSNYVKEMELGHERRGLEIAMSLSARGNQFLQENKLDN
TLFSQSPEKSDAVVAVGLNIIYAVSSIITPYMPEIGEKINKMLNAPALKIDDRFHLAILE
GHNINKAEYLFQRIDEKKIDEWRAKYGGQQV
Download sequence
Identical sequences B3LHX8 C8Z9F6 H0GGZ2 N1P448 P00958 W7PKT3 W7QYK8
YGR264C YGR264C 4932.YGR264C YGR264C YGR264C SCRT_00761 YGR264C YGR264C YGR264C YGR264C

Jump to [ Top of page · Domain architecture · Domain assignment details ]