SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR264C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR264C
Domain Number 1 Region: 196-332,367-577
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.48e-89
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000379
Further Details:      
 
Domain Number 2 Region: 582-747
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 8.04e-31
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00054
Further Details:      
 
Domain Number 3 Region: 333-367
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00000000000144
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex 1.423 24.49
microtubule cytoskeleton 1.341 5.48
microtubule associated complex 1.998 5.48
mitochondrial matrix 1.714 4.9
plastid 1.6 4.85
chloroplast part 1.896 4.85
plastid stroma 2.025 4.77

Protein sequence

External link(s) Locus: YGR264C   Protein: S000003496
Sequence length 751
Comment MES1 SGDID:S000003496, Chr VII from 1021859-1019604, reverse complement, Verified ORF, "Methionyl-tRNA synthetase, forms a complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p, which increases the catalytic efficiency of both tRNA synthetases; also has a role in nuclear export of tRNAs"
Sequence
MSFLISFDKSKKHPAHLQLANNLKIALALEYASKNLKPEVDNDNAAMELRNTKEPFLLFD
ANAILRYVMDDFEGQTSDKYQFALASLQNLLYHKELPQQHVEVLTNKAIENYLVELKEPL
TTTDLILFANVYALNSSLVHSKFPELPSKVHNAVALAKKHVPRDSSSFKNIGAVKIQADL
TVKPKDSEILPKPNERNILITSALPYVNNVPHLGNIIGSVLSADIFARYCKGRNYNALFI
CGTDEYGTATETKALEEGVTPRQLCDKYHKIHSDVYKWFQIGFDYFGRTTTDKQTEIAQH
IFTKLNSNGYLEEQSMKQLYCPVHNSYLADRYVEGECPKCHYDDARGDQCDKCGALLDPF
ELINPRCKLDDASPEPKYSDHIFLSLDKLESQISEWVEKASEEGNWSKNSKTITQSWLKD
GLKPRCITRDLVWGTPVPLEKYKDKVLYVWFDATIGYVSITSNYTKEWKQWWNNPEHVSL
YQFMGKDNVPFHTVVFPGSQLGTEENWTMLHHLNTTEYLQYENGKFSKSRGVGVFGNNAQ
DSGISPSVWRYYLASVRPESSDSHFSWDDFVARNNSELLANLGNFVNRLIKFVNAKYNGV
VPKFDPKKVSNYDGLVKDINEILSNYVKEMELGHERRGLEIAMSLSARGNQFLQENKLDN
TLFSQSPEKSDAVVAVGLNIIYAVSSIITPYMPEIGEKINKMLNAPALKIDDRFHLAILE
GHNINKAEYLFQRIDEKKIDEWRAKYGGQQV
Download sequence
Identical sequences B3LHX8 C8Z9F6 H0GGZ2 N1P448 P00958 W7PKT3 W7QYK8
YGR264C 4932.YGR264C YGR264C YGR264C YGR264C SCRT_00761 YGR264C YGR264C YGR264C YGR264C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]