SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR282C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR282C
Domain Number 1 Region: 32-310
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.77e-59
Family beta-glycanases 0.01
Further Details:      
 

Protein sequence

External link(s) Locus: YGR282C   Protein: S000003514
Sequence length 313
Comment BGL2 SGDID:S000003514, Chr VII from 1058731-1057790, reverse complement, Verified ORF, "Endo-beta-1,3-glucanase, major protein of the cell wall, involved in cell wall maintenance"
Sequence
MRFSTTLATAATALFFTASQVSAIGELAFNLGVKNNDGTCKSTSDYETELQALKSYTSTV
KVYAASDCNTLQNLGPAAEAEGFTIFVGVWPTDDSHYAAEKAALQTYLPKIKESTVAGFL
VGSEALYRNDLTASQLSDKINDVRSVVADISDSDGKSYSGKQVGTVDSWNVLVAGYNSAV
IEASDFVMANAFSYWQGQTMQNASYSFFDDIMQALQVIQSTKGSTDITFWVGETGWPTDG
TNFESSYPSVDNAKQFWKEGICSMRAWGVNVIVFEAFDEDWKPNTSGTSDVEKHWGVFTS
SDNLKYSLDCDFS
Download sequence
Identical sequences A6ZUT8 B3LHW3 C7GNF3 C8Z9H5 E7KCZ4 E7KNY1 E7LV22 E7QFD6 F8KAD4 G2WF05 H0GH08 N1P4I5 P15703 W7PKU9 W7RBM7
YGR282C YGR282C YGR282C YGR282C YGR282C YGR282C YGR282C 4932.YGR282C YGR282C SCRT_00745 YGR282C YGR282C tr|A6ZUT8|A6ZUT8_YEAS7 YGR282C YGR282C YGR282C YGR282C YGR282C YGR282C

Jump to [ Top of page · Domain architecture · Domain assignment details ]