SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR290W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YGR290W   Protein: S000003522
Sequence length 147
Comment YGR290W SGDID:S000003522, Chr VII from 1075489-1075932, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; putative HLH protein; partially overlaps the verified ORF MAL11/YGR289C (a high-affinity maltose transporter)"
Sequence
MDHRAAFGYFSNACFKVMLFSSLLASFASSVAFISLITFSLSSSESPNWAELVVNSKWSS
SKALSFFPSSKSSVLKTSCWFTISLEDSEMFLSSFFEAAFFLLTNEMIFFILYYFFSCLM
FFYVASERNTNPKILQTINTKPLYIKN
Download sequence
Identical sequences P53339
YGR290W YGR290W 4932.YGR290W YGR290W YGR290W YGR290W

Jump to [ Top of page · Domain architecture · Domain assignment details ]