SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YGR290W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YGR290W   Protein: S000003522
Sequence length 147
Comment YGR290W SGDID:S000003522, Chr VII from 1075489-1075932, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; putative HLH protein; partially overlaps the verified ORF MAL11/YGR289C (a high-affinity maltose transporter)"
Sequence
MDHRAAFGYFSNACFKVMLFSSLLASFASSVAFISLITFSLSSSESPNWAELVVNSKWSS
SKALSFFPSSKSSVLKTSCWFTISLEDSEMFLSSFFEAAFFLLTNEMIFFILYYFFSCLM
FFYVASERNTNPKILQTINTKPLYIKN
Download sequence
Identical sequences P53339
YGR290W YGR290W 4932.YGR290W YGR290W YGR290W YGR290W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]