SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR296W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR296W
Domain Number 1 Region: 864-919,946-1023,1072-1207
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-26
Family Tandem AAA-ATPase domain 0.0036
Further Details:      
 
Domain Number 2 Region: 36-120
Classification Level Classification E-value
Superfamily ORC1-binding domain 8.89e-06
Family ORC1-binding domain 0.016
Further Details:      
 
Weak hits

Sequence:  YGR296W
Domain Number - Region: 103-163
Classification Level Classification E-value
Superfamily LemA-like 0.0392
Family LemA-like 0.016
Further Details:      
 

Protein sequence

External link(s) Locus: YGR296W   Protein: S000003528
Sequence length 1859
Comment YRF1-3 SGDID:S000003528, Chr VII from 1084871-1084889,1085038-1090598, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p"
Sequence
MEIENEQICTCIAQILHLLNSLIITFLDDDKTETGQSFVYIDGFLVKKHNNQHTIVNFET
YKNKMKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIK
VVKFRTGAMDRKRSFEKIVVSVMVGKNVQKFLTFVEDEPDFQGGPIPSKYLIPKKINLMV
YTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERCYEIASARPNDSSTMRTFTDF
VSGTPIVRGLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERLKRDL
CPRKPTEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSITNEE
PIIPSVDEHGLKVCKLRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWK
WIKILYHEVAQETALKDSYRITLVPSSDGVSVCGKLFNREYVRGFYFACKAQFDNLWEEL
NDCFYMPTVVDIASLILRNREVLFREPKRGIDEYLENDSFLQMIPVKYREIVLPKLRRDT
NKMTAALKNKVTVAIDELTVPLMWMIHFAVGYPYRYPELQLLAFAGPQRNVYVDDTTRRI
QLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWMDVVGF
EDPDQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLI
ALGRHCVGSRFETDLYESATSELMANHSVQTGRNIYGVDSFSLTSVSGTTATLLQERASE
RWIQWLGLESDYHCSFSSTRNAEDVVAGEAASSDHHQKISRVTRKRPREPKSTNDILVAG
QKLFGSSFEFRDLHQLRLCHEIYMADTPSVAVQAPPGYGKTELFHLPLIALASKGDVKYV
SFLFVPYTVLLANCMIRLSRCGCLNVAPVRNFIEEGCDGVTDLYVGIYDDLASTNFTDRI
AAWENIVECTFRTNNVKLGYLIVDEFHNFETEVYRQSQFGGITNLDFDAFEKAIFLSGTA
PEAVADAALQRIGLTGLAKKSMDINELKRSEDLSRGLSSYPTRMFNLIKEKSEVPLGHVH
KIWKKVESQPEEALKLLLALFEIEPESKAIVVASTTNEVEELACSWRKYFRVVWIHGKLG
AAEKVSRTKEFVTDGSMRVLIGTKLVTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDG
GLCYLLSRKNSWAARNRKGELPPIKEGCITEQVREFYGLESKKGKKGQHVGCCGSRTDLS
ADTVELIERMDRLAEKQATASMSIVALPSSFQESNSSDRCRKYCSSDEDSDTCIHGSANA
STNATTNSSTNATTTASTNVRTSATTTASINVRTSATTTESTNSSTNATTTASTNVRTSA
TTTASINVRTSATTTESTNSNTSATTTESTDSNTSATTTESTDSNTSATTTASTNSSTNA
TTTASTNSSTNATTTESTNASAKEDANKDGNAEDNRFHPVTDINKESYKRKGSQMVLLER
KKLKAQFPNTSENMNVLQFLGFRSDEIKHLFLYGIDVYFCPEGVFTQYGLCKGCQKMFEL
CVCWAGQKVSYRRMAWEALAVERMLRNDEEYKEYLEDIEPYHGDPVGYLKYFSVKRGEIY
SQIQRNYAWYLAITRRRETISVLDSTRGKQGSQVFRMSGRQIKELYYKVWSNLRESKTEV
LQYFLNWDEKKCREEWEAKDDTVFVEALEKVGVFQRLRSMTSAGLQGPQYVKLQFSRHHR
QLRSRYELSLGMHLRDQLALGVTPSKVPHWTAFLSMLIGLFCNKTFRQKLEYLLEQISEV
WLLPHWLDLANVEVLAADNTRVPLYMLMVAVHKELDSDDVPDGRFDILLCRDSSREVGE
Download sequence
Identical sequences P0CX14 P0CX15
YGR296W YPL283C 4932.YGR296W 4932.YPL283C YGR296W YPL283C YGR296W YPL283C

Jump to [ Top of page · Domain architecture · Domain assignment details ]