SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YGR296W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR296W
Domain Number 1 Region: 864-919,946-1023,1072-1207
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-26
Family Tandem AAA-ATPase domain 0.0036
Further Details:      
 
Domain Number 2 Region: 36-120
Classification Level Classification E-value
Superfamily ORC1-binding domain 0.00000889
Family ORC1-binding domain 0.016
Further Details:      
 
Weak hits

Sequence:  YGR296W
Domain Number - Region: 103-163
Classification Level Classification E-value
Superfamily LemA-like 0.0392
Family LemA-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule cytoskeleton 1.341 26.13
microtubule associated complex 1.998 25.22
chromosomal part 1.477 20.37
cilium 1.573 16.39
nucleoplasm part 1.496 15.57
endosome 1.323 14.1
extrinsic component of plasma membrane 1.992 13.97
extracellular organelle 1.606 12.21
SWI/SNF superfamily-type complex 2.178 9.4
lateral plasma membrane 1.933 9.04

Protein sequence

External link(s) Locus: YGR296W   Protein: S000003528
Sequence length 1859
Comment YRF1-3 SGDID:S000003528, Chr VII from 1084871-1084889,1085038-1090598, Verified ORF, "Helicase encoded by the Y' element of subtelomeric regions, highly expressed in the mutants lacking the telomerase component TLC1; potentially phosphorylated by Cdc28p"
Sequence
MEIENEQICTCIAQILHLLNSLIITFLDDDKTETGQSFVYIDGFLVKKHNNQHTIVNFET
YKNKMKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIK
VVKFRTGAMDRKRSFEKIVVSVMVGKNVQKFLTFVEDEPDFQGGPIPSKYLIPKKINLMV
YTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERCYEIASARPNDSSTMRTFTDF
VSGTPIVRGLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQASLPGEKKVDTERLKRDL
CPRKPTEIKYFSQICNDMMNKKDRLGDILHIILRACALNFGAGPRGGAGDEEDRSITNEE
PIIPSVDEHGLKVCKLRSPNTPRRLRKTLDAVKALLVSSCACTARDLDIFDDNNGVAMWK
WIKILYHEVAQETALKDSYRITLVPSSDGVSVCGKLFNREYVRGFYFACKAQFDNLWEEL
NDCFYMPTVVDIASLILRNREVLFREPKRGIDEYLENDSFLQMIPVKYREIVLPKLRRDT
NKMTAALKNKVTVAIDELTVPLMWMIHFAVGYPYRYPELQLLAFAGPQRNVYVDDTTRRI
QLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALGNSYDAFNHDPWMDVVGF
EDPDQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRELPKNAPQKLNFREMRQGLI
ALGRHCVGSRFETDLYESATSELMANHSVQTGRNIYGVDSFSLTSVSGTTATLLQERASE
RWIQWLGLESDYHCSFSSTRNAEDVVAGEAASSDHHQKISRVTRKRPREPKSTNDILVAG
QKLFGSSFEFRDLHQLRLCHEIYMADTPSVAVQAPPGYGKTELFHLPLIALASKGDVKYV
SFLFVPYTVLLANCMIRLSRCGCLNVAPVRNFIEEGCDGVTDLYVGIYDDLASTNFTDRI
AAWENIVECTFRTNNVKLGYLIVDEFHNFETEVYRQSQFGGITNLDFDAFEKAIFLSGTA
PEAVADAALQRIGLTGLAKKSMDINELKRSEDLSRGLSSYPTRMFNLIKEKSEVPLGHVH
KIWKKVESQPEEALKLLLALFEIEPESKAIVVASTTNEVEELACSWRKYFRVVWIHGKLG
AAEKVSRTKEFVTDGSMRVLIGTKLVTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDG
GLCYLLSRKNSWAARNRKGELPPIKEGCITEQVREFYGLESKKGKKGQHVGCCGSRTDLS
ADTVELIERMDRLAEKQATASMSIVALPSSFQESNSSDRCRKYCSSDEDSDTCIHGSANA
STNATTNSSTNATTTASTNVRTSATTTASINVRTSATTTESTNSSTNATTTASTNVRTSA
TTTASINVRTSATTTESTNSNTSATTTESTDSNTSATTTESTDSNTSATTTASTNSSTNA
TTTASTNSSTNATTTESTNASAKEDANKDGNAEDNRFHPVTDINKESYKRKGSQMVLLER
KKLKAQFPNTSENMNVLQFLGFRSDEIKHLFLYGIDVYFCPEGVFTQYGLCKGCQKMFEL
CVCWAGQKVSYRRMAWEALAVERMLRNDEEYKEYLEDIEPYHGDPVGYLKYFSVKRGEIY
SQIQRNYAWYLAITRRRETISVLDSTRGKQGSQVFRMSGRQIKELYYKVWSNLRESKTEV
LQYFLNWDEKKCREEWEAKDDTVFVEALEKVGVFQRLRSMTSAGLQGPQYVKLQFSRHHR
QLRSRYELSLGMHLRDQLALGVTPSKVPHWTAFLSMLIGLFCNKTFRQKLEYLLEQISEV
WLLPHWLDLANVEVLAADNTRVPLYMLMVAVHKELDSDDVPDGRFDILLCRDSSREVGE
Download sequence
Identical sequences P0CX14 P0CX15
YGR296W YPL283C YGR296W YPL283C 4932.YGR296W 4932.YPL283C YGR296W YPL283C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]