SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHL009W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YHL009W-A   Protein: S000007371
Sequence length 413
Comment YHL009W-A SGDID:S000007371, Chr VIII from 85905-87146, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MATPVRDETRNVIDDNISARIQSKVKTNDTVRQTPSSLRKVSIKDEQVKQYQRNLNRFKT
ILNGLKAEEEKLSETDDIQMLAEKLLKLGETIDKVENRIVDLVEKIQLLETNENNNILHE
HIDATGTYYLFDTLTSTNKRFYPKDCVFDYRTNNVENIPILLNNFKKFIKKYQFDDVFEN
DIIEIDPRENEILCKIIKEGLGESLDIMNTNTTDIFRIIDGLKNKYRSLHGRDVRIRAWE
KVLVDTTCRNSALLMNKLQKLVLMEKWIFSKCCQDCPNLKDYLQEAIMGTLHESLRNSVK
QRLYNIPHNVGINHEEFLINTVIETVIDLSPIADDQIENSCMYCKSVFHCSINCKKKPNR
ELRPDSTNFSKTYYLQGAQRQQQLKSSAKRTKVLEQDTKKVKQSVQQQKTGNY
Download sequence
Identical sequences N1P1F0 Q6Q5P6
YHL009W-A YHL009W-A YHL009W-A 4932.YHL009W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]