SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHL009W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHL009W-A   Protein: S000007371
Sequence length 413
Comment YHL009W-A SGDID:S000007371, Chr VIII from 85905-87146, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MATPVRDETRNVIDDNISARIQSKVKTNDTVRQTPSSLRKVSIKDEQVKQYQRNLNRFKT
ILNGLKAEEEKLSETDDIQMLAEKLLKLGETIDKVENRIVDLVEKIQLLETNENNNILHE
HIDATGTYYLFDTLTSTNKRFYPKDCVFDYRTNNVENIPILLNNFKKFIKKYQFDDVFEN
DIIEIDPRENEILCKIIKEGLGESLDIMNTNTTDIFRIIDGLKNKYRSLHGRDVRIRAWE
KVLVDTTCRNSALLMNKLQKLVLMEKWIFSKCCQDCPNLKDYLQEAIMGTLHESLRNSVK
QRLYNIPHNVGINHEEFLINTVIETVIDLSPIADDQIENSCMYCKSVFHCSINCKKKPNR
ELRPDSTNFSKTYYLQGAQRQQQLKSSAKRTKVLEQDTKKVKQSVQQQKTGNY
Download sequence
Identical sequences N1P1F0 Q6Q5P6
YHL009W-A 4932.YHL009W-A YHL009W-A YHL009W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]