SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHL032C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHL032C
Domain Number 1 Region: 396-693
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.4e-59
Family Glycerol kinase 6.73e-06
Further Details:      
 
Domain Number 2 Region: 143-395
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.77e-48
Family Glycerol kinase 1.81e-05
Further Details:      
 
Weak hits

Sequence:  YHL032C
Domain Number - Region: 48-84
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.000453
Family Glycerol kinase 0.04
Further Details:      
 

Protein sequence

External link(s) Locus: YHL032C   Protein: S000001024
Sequence length 709
Comment GUT1 SGDID:S000001024, Chr VIII from 38506-36377, reverse complement, Verified ORF, "Glycerol kinase, converts glycerol to glycerol-3-phosphate; glucose repression of expression is mediated by Adr1p and Ino2p-Ino4p; derepression of expression on non-fermentable carbon sources is mediated by Opi1p and Rsf1p"
Sequence
MFPSLFRLVVFSKRYIFRSSQRLYTSLKQEQSRMSKIMEDLRSDYVPLIASIDVGTTSSR
CILFNRWGQDVSKHQIEYSTSASKGKIGVSGLRRPSTAPARETPNAGDIKTSGKPIFSAE
GYAIQETKFLKIEELDLDFHNEPTLKFPKPGWVECHPQKLLVNVVQCLASSLLSLQTINS
ERVANGLPPYKVICMGIANMRETTILWSRRTGKPIVNYGIVWNDTRTIKIVRDKWQNTSV
DRQLQLRQKTGLPLLSTYFSCSKLRWFLDNEPLCTKAYEENDLMFGTVDTWLIYQLTKQK
AFVSDVTNASRTGFMNLSTLKYDNELLEFWGIDKNLIHMPEIVSSSQYYGDFGIPDWIME
KLHDSPKTVLRDLVKRNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTGTKK
LISQHGALTTLAFWFPHLQEYGGQKPELSKPHFALEGSVAVAGAVVQWLRDNLRLIDKSE
DVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIARAAVEGVCFQ
ARAILKAMSSDAFGEGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILG
PCVKVRRSPTAECTALGAAIAANMAFKDVNERPLWKDLHDVKKWVFYNGMEKNEQISPEA
HPNLKIFRSESDDAERRKHWKYWEVAVERSKGWLKDIEGEHEQVLENFQ
Download sequence
Identical sequences P32190
YHL032C 4932.YHL032C YHL032C YHL032C YHL032C YHL032C

Jump to [ Top of page · Domain architecture · Domain assignment details ]