SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YHL032C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHL032C
Domain Number 1 Region: 396-693
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.4e-59
Family Glycerol kinase 0.00000673
Further Details:      
 
Domain Number 2 Region: 143-395
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.77e-48
Family Glycerol kinase 0.0000181
Further Details:      
 
Weak hits

Sequence:  YHL032C
Domain Number - Region: 48-84
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.000453
Family Glycerol kinase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear chromosome 1.723 22.88
chromosomal part 1.478 22.88
chromatin 1.906 22.88
cilium 1.61 19.62
actin filament 2.158 18.06
SWI/SNF superfamily-type complex 2.177 16.17
cation channel complex 2.038 14.35
endoplasmic reticulum part 1.429 13.39
cytosol 1.305 8.51
microtubule cytoskeleton 1.333 8.23

Protein sequence

External link(s) Locus: YHL032C   Protein: S000001024
Sequence length 709
Comment GUT1 SGDID:S000001024, Chr VIII from 38506-36377, reverse complement, Verified ORF, "Glycerol kinase, converts glycerol to glycerol-3-phosphate; glucose repression of expression is mediated by Adr1p and Ino2p-Ino4p; derepression of expression on non-fermentable carbon sources is mediated by Opi1p and Rsf1p"
Sequence
MFPSLFRLVVFSKRYIFRSSQRLYTSLKQEQSRMSKIMEDLRSDYVPLIASIDVGTTSSR
CILFNRWGQDVSKHQIEYSTSASKGKIGVSGLRRPSTAPARETPNAGDIKTSGKPIFSAE
GYAIQETKFLKIEELDLDFHNEPTLKFPKPGWVECHPQKLLVNVVQCLASSLLSLQTINS
ERVANGLPPYKVICMGIANMRETTILWSRRTGKPIVNYGIVWNDTRTIKIVRDKWQNTSV
DRQLQLRQKTGLPLLSTYFSCSKLRWFLDNEPLCTKAYEENDLMFGTVDTWLIYQLTKQK
AFVSDVTNASRTGFMNLSTLKYDNELLEFWGIDKNLIHMPEIVSSSQYYGDFGIPDWIME
KLHDSPKTVLRDLVKRNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTGTKK
LISQHGALTTLAFWFPHLQEYGGQKPELSKPHFALEGSVAVAGAVVQWLRDNLRLIDKSE
DVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIARAAVEGVCFQ
ARAILKAMSSDAFGEGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILG
PCVKVRRSPTAECTALGAAIAANMAFKDVNERPLWKDLHDVKKWVFYNGMEKNEQISPEA
HPNLKIFRSESDDAERRKHWKYWEVAVERSKGWLKDIEGEHEQVLENFQ
Download sequence
Identical sequences P32190
YHL032C YHL032C 4932.YHL032C YHL032C YHL032C YHL032C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]