SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YHL032C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHL032C
Domain Number 1 Region: 396-693
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.4e-59
Family Glycerol kinase 0.00000673
Further Details:      
 
Domain Number 2 Region: 143-395
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.77e-48
Family Glycerol kinase 0.0000181
Further Details:      
 
Weak hits

Sequence:  YHL032C
Domain Number - Region: 48-84
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.000453
Family Glycerol kinase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
focal adhesion 1.815 31.8
cell-substrate junction 1.548 29.33
actin-based cell projection 1.622 26.82
chromosomal part 1.512 21.28
chromatin 1.876 21.28
nuclear chromosome part 1.842 21.28
cell leading edge 1.426 21.26
cell body 1.534 14.49
actin cytoskeleton 1.374 13.46
transporter complex 1.698 13.35

Protein sequence

External link(s) Locus: YHL032C   Protein: S000001024
Sequence length 709
Comment GUT1 SGDID:S000001024, Chr VIII from 38506-36377, reverse complement, Verified ORF, "Glycerol kinase, converts glycerol to glycerol-3-phosphate; glucose repression of expression is mediated by Adr1p and Ino2p-Ino4p; derepression of expression on non-fermentable carbon sources is mediated by Opi1p and Rsf1p"
Sequence
MFPSLFRLVVFSKRYIFRSSQRLYTSLKQEQSRMSKIMEDLRSDYVPLIASIDVGTTSSR
CILFNRWGQDVSKHQIEYSTSASKGKIGVSGLRRPSTAPARETPNAGDIKTSGKPIFSAE
GYAIQETKFLKIEELDLDFHNEPTLKFPKPGWVECHPQKLLVNVVQCLASSLLSLQTINS
ERVANGLPPYKVICMGIANMRETTILWSRRTGKPIVNYGIVWNDTRTIKIVRDKWQNTSV
DRQLQLRQKTGLPLLSTYFSCSKLRWFLDNEPLCTKAYEENDLMFGTVDTWLIYQLTKQK
AFVSDVTNASRTGFMNLSTLKYDNELLEFWGIDKNLIHMPEIVSSSQYYGDFGIPDWIME
KLHDSPKTVLRDLVKRNLPIQGCLGDQSASMVGQLAYKPGAAKCTYGTGCFLLYNTGTKK
LISQHGALTTLAFWFPHLQEYGGQKPELSKPHFALEGSVAVAGAVVQWLRDNLRLIDKSE
DVGPIASTVPDSGGVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIARAAVEGVCFQ
ARAILKAMSSDAFGEGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILG
PCVKVRRSPTAECTALGAAIAANMAFKDVNERPLWKDLHDVKKWVFYNGMEKNEQISPEA
HPNLKIFRSESDDAERRKHWKYWEVAVERSKGWLKDIEGEHEQVLENFQ
Download sequence
Identical sequences P32190
YHL032C YHL032C YHL032C YHL032C 4932.YHL032C YHL032C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]