SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHL033C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHL033C
Domain Number 1 Region: 87-220
Classification Level Classification E-value
Superfamily L30e-like 7.66e-31
Family L30e/L7ae ribosomal proteins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribonucleoprotein complex 1.415 25.21
ribosomal subunit 2.011 14.29
nucleolus 1.651 7.4
cytosol 1.305 4.52
cytosolic ribosome 2.218 3.56

Protein sequence

External link(s) Locus: YHL033C   Protein: S000001025
Sequence length 256
Comment RPL8A SGDID:S000001025, Chr VIII from 36023-35253, reverse complement, Verified ORF, "Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Bp and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits"
Sequence
MAPGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQR
QKKILSIRLKVPPTIAQFQYTLDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEGK
SKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIELVVFLPALCKKMGVPYAIV
KGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGN
KAQAKMDKRAKNSDSA
Download sequence
Identical sequences B3LS86 N1P4I2 P17076
YHL033C 4932.YHL033C YHL033C YHL033C SCRT_04671 1vw8.H 1vwu.H 1vxv.H 1vxy.H 3izc.H 3izs.H 3j65.H 3o58.H 3o5h.H 3u5e.G 3u5i.G 4b6a.G 4cuw.G YHL033C YHL033C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]