SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHL033C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHL033C
Domain Number 1 Region: 87-220
Classification Level Classification E-value
Superfamily L30e-like 7.66e-31
Family L30e/L7ae ribosomal proteins 0.0016
Further Details:      
 

Protein sequence

External link(s) Locus: YHL033C   Protein: S000001025
Sequence length 256
Comment RPL8A SGDID:S000001025, Chr VIII from 36023-35253, reverse complement, Verified ORF, "Ribosomal protein L4 of the large (60S) ribosomal subunit, nearly identical to Rpl8Bp and has similarity to rat L7a ribosomal protein; mutation results in decreased amounts of free 60S subunits"
Sequence
MAPGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQR
QKKILSIRLKVPPTIAQFQYTLDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEGK
SKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIELVVFLPALCKKMGVPYAIV
KGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGN
KAQAKMDKRAKNSDSA
Download sequence
Identical sequences B3LS86 P17076
YHL033C 4932.YHL033C YHL033C YHL033C SCRT_04671 3izc.H 3izs.H 3o58.H 3o5h.H 3u5e.G 3u5i.G 4b6a.G YHL033C YHL033C

Jump to [ Top of page · Domain architecture · Domain assignment details ]