SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHL034W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHL034W-A   Protein: S000028774
Sequence length 153
Comment YHL034W-A SGDID:S000028774, Chr VIII from 33174-33635, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MWVRSNYSCFSSEPVSCSISSSSFSGLITATSTVNSLSPKTLPLNSSALASISTFSPLKV
TNAIPLLAESDVKILPVCWSLIFLIGKEMESASVPKNSATSSLVALNGTLLIYKVSFDLS
IWSNGIFSLFCPLKPPLAPPLPLKFPLPLKPPL
Download sequence
Identical sequences C8ZA28
YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A 4932.YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A YHL034W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]