SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHL046W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YHL046W-A   Protein: S000028775
Sequence length 108
Comment YHL046W-A SGDID:S000028775, Chr VIII from 9979-10305, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MNAENRNIAFNCQVSYFLAISSDLRIINDFVPFNLSFISSLGDESSSIFSSTISSLQFFS
VFLRFVWLERLSSGTSIIFPLAQRVTTVFGAQVERTQAKFFYQDLMSL
Download sequence
Identical sequences YHL046W-A YHL046W-A YHL046W-A YHL046W-A YHL046W-A YHL046W-A 4932.YHL046W-A YHL046W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]