SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YHL046W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YHL046W-A   Protein: S000028775
Sequence length 108
Comment YHL046W-A SGDID:S000028775, Chr VIII from 9979-10305, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MNAENRNIAFNCQVSYFLAISSDLRIINDFVPFNLSFISSLGDESSSIFSSTISSLQFFS
VFLRFVWLERLSSGTSIIFPLAQRVTTVFGAQVERTQAKFFYQDLMSL
Download sequence
Identical sequences YHL046W-A YHL046W-A 4932.YHL046W-A YHL046W-A YHL046W-A YHL046W-A YHL046W-A YHL046W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]